DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-II and CG31773

DIOPT Version :9

Sequence 1:NP_001014485.3 Gene:side-II / 3346206 FlyBaseID:FBgn0259213 Length:1064 Species:Drosophila melanogaster
Sequence 2:NP_722953.1 Gene:CG31773 / 326159 FlyBaseID:FBgn0051773 Length:758 Species:Drosophila melanogaster


Alignment Length:655 Identity:113/655 - (17%)
Similarity:200/655 - (30%) Gaps:254/655 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 AGIPLYSFDVRDKESREQPRHWSAPEVFGSRAKFHFD-SQPATLEIKRHDQGIYRCRVDFRTSQT 151
            :|.|...|...:..|...|.. |:|..|.:..|.... .|......:..|.|.      |:.:.:
  Fly   138 SGPPKNQFSQANNPSFAMPGQ-SSPANFSAAPKTQASWQQKVEKSAENEDSGA------FKGASS 195

  Fly   152 QSFRFNLSVIILPEQPIIMDRWGRQLNGTQLGPKQEGDDIVITCRVVGGRPQPQVRWLVNGLLVD 216
            :|.|.|               |..::.|:|                    .:.|.:|     |.:
  Fly   196 ESQRKN---------------WMNRMQGSQ--------------------QRKQNQW-----LKE 220

  Fly   217 NQNEHNSGDVIENRLLWPSVQRNDLNSVFTCQALNTQ---------LDKPKEKSFILDMHLKPL- 271
            .|.:..:|..|:.:    .:|:.:.....|..|...:         .:||:|||   ..||..| 
  Fly   221 MQAKQQAGKDIQAQ----KMQKMESQKATTTPAAPPKEAAPSTPQPAEKPEEKS---PEHLAYLD 278

  Fly   272 VVK------ILEPPSSMIADRRYEVSCESSGSRPNAIITWYKGKRQLRRTKDDISKNS-TRSELS 329
            .:|      :|||.|.       ..:.:||....:.:|         .:|.:.:.|:. |:.:|.
  Fly   279 AIKQLNSYQVLEPTSG-------RATTKSSRKEQDPVI---------EQTLECLEKSGLTKKDLK 327

  Fly   330 FVP---TTDDDGKSITC------------------------RAENPNVNG------LYLETMWKL 361
            .:|   .....|:..||                        .:|...::|      .:.|..||:
  Fly   328 AIPVIQVAGSKGRGSTCAIVESILRCHGVKTGVLSSPHLFLTSERIRIDGEPLSDVQFTELFWKI 392

  Fly   362 NVVYPPLVTLRLGSTLTPDDIKEGDDVYFECHVQSNPQWRKLLWLHNGIHLEHNTSARVIRSNQS 426
            |.                 |:         .::|..|.:.|::.: ...|..|.....|      
  Fly   393 NT-----------------DL---------ANMQPTPSYNKIMTV-MAFHAFHQAGVEV------ 424

  Fly   427 LVLQKITKHYAGNYACSAINDEGETVSNQLPLRVKYTPMCKHADRVILIGASKDETVEVVCEIQA 491
            .:|:      .||...|                 ..|.:..||           :|:.:.     
  Fly   425 AILE------VGNAGAS-----------------DATNIASHA-----------QTIGIT----- 450

  Fly   492 DPPPRTFRW-KFNNSGETL-DVGSERFSVNGSRSILKYTPVTDQDYGTLSCWASNEVGTQQHPCL 554
                 |..| :.:|.|.:| |:...:.|:....:.: ||.||..:...:....:.::|.|     
  Fly   451 -----TLGWEQSSNLGNSLRDIAWAKASIMKPEANI-YTNVTQTECCEVLAQKAKQIGAQ----- 504

  Fly   555 FQVVLAALP-------NAVSNCTVFNRTELSVDIQCIPGYDGGL-------------PQIFV-LE 598
                |..:|       ..::|..:.|:...|:.:      :|.|             |:..| ||
  Fly   505 ----LRRVPTFNDYVEGDMNNKLLMNKANYSMRL------NGSLAVQLAYDFLKRHKPEYVVGLE 559

  Fly   599 MFST--RTGITR----------FNLSNAEEALFSLENLDTLTSMMVQENNSLRLRIYSYNQKGRS 651
            ..||  ..|.:|          |:....:.....|::.||..|||     :.|...|:..:..|.
  Fly   560 HNSTLLTPGASRGIEIFEQPGHFDFMRHDMFNVYLDSADTFESMM-----ACRDWFYTRTRANRQ 619

  Fly   652 AAYLL 656
            ...||
  Fly   620 PKILL 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IINP_001014485.3 IG_like 55..160 CDD:214653 16/72 (22%)
Ig 57..160 CDD:299845 16/72 (22%)
Ig 188..251 CDD:299845 9/62 (15%)
Ig 289..363 CDD:299845 16/107 (15%)
IG_like 289..351 CDD:214653 12/89 (13%)
Ig_2 376..460 CDD:290606 11/83 (13%)
IG_like 383..454 CDD:214653 10/70 (14%)
Ig 470..548 CDD:299845 12/79 (15%)
IG_like 481..557 CDD:214653 14/77 (18%)
CG31773NP_722953.1 folC 309..745 CDD:273659 70/423 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.