DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-II and Ptgfrn

DIOPT Version :10

Sequence 1:NP_001400995.1 Gene:side-II / 3346206 FlyBaseID:FBgn0259213 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_062116.2 Gene:Ptgfrn / 29602 RGDID:3437 Length:879 Species:Rattus norvegicus


Alignment Length:637 Identity:136/637 - (21%)
Similarity:227/637 - (35%) Gaps:170/637 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KDIDAVEGKSVSLPCPI-TEPLDNVY-MVLW-FRDNAGIPLYSFDVRDKESREQPRHWSAPEVFG 116
            :.:...|||.:.|.|.| |:.:|:|. .|.| |:......|.:..:..:..|:...| |:|.|  
  Rat   285 RTVSVTEGKDLDLSCNITTDRVDDVRPEVTWYFKKTPDTSLLASHMLARLDRDSLVH-SSPHV-- 346

  Fly   117 SRAKFHFDSQPATLEIKDIKRHDQGIYRCRVDF----------RTSQTQSFRFNLSVIIL-PEQP 170
              |..|.|::...|.::|:.:.:.|.|.|.|..          :.::..|....:||..| ||..
  Rat   347 --ALSHVDTRSYHLLVRDVSKENSGYYLCLVALWAPGHNRSWHKVAEAMSAPSGVSVTWLEPEYQ 409

  Fly   171 IIMDRWGRQLNGTQLGPKQEGDDIVITCRVVG-GRPQPQVRWLVNGLLVDNQNEHNSGDVIENRL 234
            :       .||.::: |....|...:.|||:. .|....||..|:...  ..|..|. ||:.:.|
  Rat   410 V-------YLNASKV-PGFSDDPTELQCRVIDTKRVDAGVRLTVSWYY--RMNRRND-DVVASEL 463

  Fly   235 L------WP------SVQR-NDLNSVFTCQALNT---QLDKPKEK------------------SF 265
            |      |.      |.|| .|...:|:.:..:|   ::.:..|:                  |:
  Rat   464 LAVMDGDWTLRYGERSKQRAQDGEFIFSKEHTDTFSFRIQRTTEEDRGSYYCVVSAWTRQRNSSW 528

  Fly   266 I--LDMHLKP-----------LVVKILEPPSSMIADRRYEVSCESSGS-----RPNAIITWYKGK 312
            :  .|:..||           ||||..:|.....|...:|::|:.|..     |.:.:||     
  Rat   529 VKSKDVFSKPVNIFWASEDSVLVVKARQPKPFFAAGNTFEMTCKVSSKNIKSPRYSVLIT----- 588

  Fly   313 RQLRRTKDDISKNSTRSELSFVPTTDDDGKSITCRAEN----PNVNGLYLETMWKLNVVYPPLVT 373
                 .:..:...|:.:|..::.:.|.|.   ..:.||    ..|:|:.||.:.:....|     
  Rat   589 -----AEKPVGDLSSPNETKYIISLDQDS---VVKLENWTDASRVDGVVLEKVQEDEFRY----- 640

  Fly   374 LRLGSTLTPDDIKEGDDVYFECHVQSNPQWRKL---LW------LHNGIHLEHNTSARVIRSNQS 429
             |:..|      :..|...:.|.|.:   |..:   ||      |.|.|.::..||..:..::..
  Rat   641 -RMYQT------QVSDAGLYRCMVTA---WSPIGGSLWREAATSLSNPIEIDFQTSGPIFNASVH 695

  Fly   430 LVLQKITKHYAGNYACSAINDEGETVSNQLPLRVKYTPMCKHA---DRVILIGASKDETVEVVCE 491
            .....:|:.......|....|......:.:...|.:  ...|:   |:..::.:|.|.. .||..
  Rat   696 SDTLSVTRGDLIKLFCIVTVDGAVLDPDDMAFDVSW--FAVHSFGLDKAPILLSSLDRK-GVVTT 757

  Fly   492 IQADPPPRTFRWKFNNSGETLDVGSERFSVNGSRSILKYTPVTDQDYGTLSC----WASNEVGTQ 552
            .|.|       ||...|.|.:.|......|:||.         |||:|...|    |..:..|:.
  Rat   758 GQRD-------WKSTVSLERVSVLEFLLQVHGSE---------DQDFGNYYCSVTPWVRSPTGSW 806

  Fly   553 QHPC------LFQVVLAALPNA--------VSNCTVFNRTELSVDIQCIPGY 590
            |...      :|..|...:.||        |...||...      :.|:.||
  Rat   807 QREAEIHSRPIFITVKMDVLNAFKYPLLIGVGLSTVIGL------LSCLIGY 852

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IINP_001400995.1 V-set 55..163 CDD:462230 28/120 (23%)
Ig_3 190..254 CDD:464046 20/77 (26%)
Ig <292..366 CDD:472250 16/82 (20%)
Ig strand B 292..295 CDD:409418 1/2 (50%)
Ig strand C 305..309 CDD:409418 2/3 (67%)
Ig strand E 329..333 CDD:409418 1/3 (33%)
Ig strand F 343..348 CDD:409418 0/4 (0%)
Ig strand G 359..362 CDD:409418 1/2 (50%)
Ig 382..457 CDD:472250 14/83 (17%)
Ig strand B 391..395 CDD:409405 0/3 (0%)
Ig strand C 405..409 CDD:409405 2/12 (17%)
Ig strand E 428..432 CDD:409405 0/3 (0%)
Ig strand F 442..447 CDD:409405 1/4 (25%)
Ig 486..554 CDD:409353 19/71 (27%)
Ig strand B 486..490 CDD:409353 1/3 (33%)
Ig strand C 500..504 CDD:409353 0/3 (0%)
Ig strand E 526..530 CDD:409353 0/3 (0%)
Ig strand F 540..545 CDD:409353 1/8 (13%)
PtgfrnNP_062116.2 IGv 39..121 CDD:214650
Cell attachment site. /evidence=ECO:0000255 89..91
Ig strand E 102..106 CDD:409378
Ig <104..140 CDD:472250
Ig strand F 116..121 CDD:409512
Ig strand G 134..137 CDD:409512
Ig 153..254 CDD:472250
Ig strand B 165..169 CDD:409355
Ig strand C 182..186 CDD:409355
Ig strand E 230..234 CDD:409355
Ig strand F 244..249 CDD:409355
Ig 283..373 CDD:472250 25/92 (27%)
Ig 423..520 CDD:472250 22/99 (22%)
Endoplasmic reticulum retention signal 424..427 0/2 (0%)
Ig strand B 425..429 CDD:409355 0/3 (0%)
Ig strand C 439..448 CDD:409355 3/8 (38%)
Ig strand E 498..502 CDD:409355 0/3 (0%)
Ig strand F 512..517 CDD:409355 0/4 (0%)
Cell attachment site. /evidence=ECO:0000255 703..705 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.