Sequence 1: | NP_001014485.3 | Gene: | side-II / 3346206 | FlyBaseID: | FBgn0259213 | Length: | 1064 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_724715.1 | Gene: | CG30350 / 246556 | FlyBaseID: | FBgn0050350 | Length: | 369 | Species: | Drosophila melanogaster |
Alignment Length: | 200 | Identity: | 41/200 - (20%) |
---|---|---|---|
Similarity: | 59/200 - (29%) | Gaps: | 96/200 - (48%) |
- Green bases have known domain annotations that are detailed below.
Fly 353 LYLETMWKLNVVYPPLVTLRLGSTLTPDDIKEGDDVYFECHVQSNPQWRKL---LWLHNGIHLEH 414
Fly 415 NTSARVIRSNQSLVLQ------KITKHYAGNYACSAINDEGETVSNQLPLRVKYTPMCKHADRVI 473
Fly 474 LIGASKDETVEVVCEIQADPPPRTFRWKFNNSGETLDVGSERFSVNGSR----SILKYTPVTD-- 532
Fly 533 QDYGT 537 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
side-II | NP_001014485.3 | IG_like | 55..160 | CDD:214653 | |
Ig | 57..160 | CDD:299845 | |||
Ig | 188..251 | CDD:299845 | |||
Ig | 289..363 | CDD:299845 | 3/9 (33%) | ||
IG_like | 289..351 | CDD:214653 | |||
Ig_2 | 376..460 | CDD:290606 | 19/92 (21%) | ||
IG_like | 383..454 | CDD:214653 | 17/79 (22%) | ||
Ig | 470..548 | CDD:299845 | 12/73 (16%) | ||
IG_like | 481..557 | CDD:214653 | 12/62 (19%) | ||
CG30350 | NP_724715.1 | KIAA1430 | 60..155 | CDD:290590 | |
cyclophilin | 212..369 | CDD:294131 | 40/199 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3515 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |