DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-II and CG30350

DIOPT Version :9

Sequence 1:NP_001014485.3 Gene:side-II / 3346206 FlyBaseID:FBgn0259213 Length:1064 Species:Drosophila melanogaster
Sequence 2:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster


Alignment Length:200 Identity:41/200 - (20%)
Similarity:59/200 - (29%) Gaps:96/200 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 LYLETMWKLNVVYPPLVTLRLGSTLTPDDIKEGDDVYFECHVQSNPQWRKL---LWLHNGIHLEH 414
            ||.|.        .|||.|:|        ||.     ..|:..|....::|   |||...:.|  
  Fly   234 LYTEA--------APLVVLQL--------IKS-----CMCNQHSKFMVKRLFPNLWLETDLML-- 275

  Fly   415 NTSARVIRSNQSLVLQ------KITKHYAGNYACSAINDEGETVSNQLPLRVKYTPMCKHADRVI 473
                    |:.||:.|      |:..|.|.:|..|.........::.|...:.:.|:        
  Fly   276 --------SSDSLLHQPLEYDAKVIDHGASSYVLSFSKAYVTGFTHHLSFAISFKPL-------- 324

  Fly   474 LIGASKDETVEVVCEIQADPPPRTFRWKFNNSGETLDVGSERFSVNGSR----SILKYTPVTD-- 532
                    ||                                  |||||    .|:|.:.:.:  
  Fly   325 --------TV----------------------------------VNGSRVGFGRIVKGSKICECI 347

  Fly   533 QDYGT 537
            |.|||
  Fly   348 QSYGT 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IINP_001014485.3 IG_like 55..160 CDD:214653
Ig 57..160 CDD:299845
Ig 188..251 CDD:299845
Ig 289..363 CDD:299845 3/9 (33%)
IG_like 289..351 CDD:214653
Ig_2 376..460 CDD:290606 19/92 (21%)
IG_like 383..454 CDD:214653 17/79 (22%)
Ig 470..548 CDD:299845 12/73 (16%)
IG_like 481..557 CDD:214653 12/62 (19%)
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590
cyclophilin 212..369 CDD:294131 40/199 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.