DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-II and Cadm2

DIOPT Version :10

Sequence 1:NP_001400995.1 Gene:side-II / 3346206 FlyBaseID:FBgn0259213 Length:1067 Species:Drosophila melanogaster
Sequence 2:XP_011244430.1 Gene:Cadm2 / 239857 MGIID:2442722 Length:458 Species:Mus musculus


Alignment Length:417 Identity:80/417 - (19%)
Similarity:136/417 - (32%) Gaps:156/417 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TKDIDAVEGKSVSLPCPITEPLDNVYMVLWFRDNAGIPLYSFDVRDKESREQPRHWSAPEVFGSR 118
            |:::..|||.:..|.|.:.:           .||..:                 .||.|    ::
Mouse    52 TQNVTVVEGGTAILTCRVDQ-----------NDNTSL-----------------QWSNP----AQ 84

  Fly   119 AKFHFDSQPA----------------TLEIKDIKRHDQGIYRCRVDFRTSQTQSFRFNLSVIILP 167
            ...:||.:.|                ::.:.|:...|:|.|.|  ...|...::.:..|:|:.:|
Mouse    85 QTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSDEGQYTC--SLFTMPVKTSKAYLTVLGVP 147

  Fly   168 EQPIIMDRWGRQLNGTQLGPKQEGDDIVITCRVVGGRPQPQVRWLVNGLLVDNQNEHNSGDVIEN 232
            |:|        |::|.. .|..|||.:.:||:..|.:|...:||..|                  
Mouse   148 EKP--------QISGFS-SPVMEGDLMQLTCKTSGSKPAADIRWFKN------------------ 185

  Fly   233 RLLWPSVQRNDLNSVFTCQALNTQLDKPKEKSFILDMHLKPLVVKILEPPSSMIADRRYEVSCES 297
                                               |..:|.  ||.|:               |.
Mouse   186 -----------------------------------DKEIKD--VKYLK---------------EE 198

  Fly   298 SGSRPNAIITWYKGKRQLRRTKDDISKNSTRSELSFVPTTDDDGKSITCRAENPNVNGLYLETMW 362
            ..:|....::                     |.|.|.....|||.::.||.::.::|......|.
Mouse   199 DANRKTFTVS---------------------STLDFRVDRSDDGVAVICRVDHESLNATPQVAMQ 242

  Fly   363 KLNVVYPPLVTLRLGSTLTPDDIKEGDDVYFECHVQSNPQWRKLLWLHNGIHLEHNTSARVIRSN 427
            .|.:.|.|.|.: :.||..|   :||..:...|..:..|....:||..:|..|.  ...|::.|.
Mouse   243 VLEIHYTPSVKI-IPSTPFP---QEGQALTLTCESKGKPLPEPVLWTKDGAELP--DPDRMVVSG 301

  Fly   428 QSLVLQKITKHYAGNYACSAINDEGET 454
            :.|.:..:.|...|.|.|.|.|..|::
Mouse   302 RELNILFLNKTDNGTYRCEATNTIGQS 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IINP_001400995.1 V-set 55..163 CDD:462230 20/123 (16%)
Ig_3 190..254 CDD:464046 10/63 (16%)
Ig <292..366 CDD:472250 13/73 (18%)
Ig strand B 292..295 CDD:409418 0/2 (0%)
Ig strand C 305..309 CDD:409418 0/3 (0%)
Ig strand E 329..333 CDD:409418 2/3 (67%)
Ig strand F 343..348 CDD:409418 1/4 (25%)
Ig strand G 359..362 CDD:409418 0/2 (0%)
Ig 382..457 CDD:472250 19/73 (26%)
Ig strand B 391..395 CDD:409405 0/3 (0%)
Ig strand C 405..409 CDD:409405 1/3 (33%)
Ig strand E 428..432 CDD:409405 1/3 (33%)
Ig strand F 442..447 CDD:409405 2/4 (50%)
Ig 486..554 CDD:409353
Ig strand B 486..490 CDD:409353
Ig strand C 500..504 CDD:409353
Ig strand E 526..530 CDD:409353
Ig strand F 540..545 CDD:409353
Cadm2XP_011244430.1 MtrA <9..>56 CDD:453061 1/3 (33%)
IgV_1_Necl-3 49..144 CDD:409498 21/125 (17%)
Ig strand A 49..52 CDD:409498 80/417 (19%)
FR1 50..68 CDD:409498 5/15 (33%)
Ig strand A' 53..59 CDD:409498 0/5 (0%)
Ig strand B 61..69 CDD:409498 2/7 (29%)
CDR1 69..74 CDD:409498 0/15 (0%)
FR2 75..82 CDD:409498 2/23 (9%)
Ig strand C 75..81 CDD:409498 1/22 (5%)
CDR2 83..94 CDD:409498 2/10 (20%)
Ig strand C' 85..89 CDD:409498 0/3 (0%)
Ig strand C' 91..94 CDD:409498 0/2 (0%)
FR3 95..130 CDD:409498 5/36 (14%)
Ig strand D 99..106 CDD:409498 0/6 (0%)
Ig strand E 109..115 CDD:409498 0/5 (0%)
Ig strand F 122..130 CDD:409498 3/9 (33%)
CDR3 131..134 CDD:409498 1/2 (50%)
Ig strand G 134..144 CDD:409498 1/9 (11%)
FR4 136..143 CDD:409498 1/6 (17%)
IgI_2_Necl-3 143..246 CDD:409467 35/202 (17%)
Ig strand A 144..147 CDD:409467 0/2 (0%)
Ig strand A' 150..154 CDD:409467 2/11 (18%)
Ig strand B 163..173 CDD:409467 3/9 (33%)
Ig strand C 176..185 CDD:409467 3/8 (38%)
Ig strand C' 186..189 CDD:409467 1/2 (50%)
Ig strand D 191..198 CDD:409467 3/23 (13%)
Ig strand E 204..214 CDD:409467 2/30 (7%)
Ig strand F 222..230 CDD:409467 2/7 (29%)
Ig strand G 238..245 CDD:409467 1/6 (17%)
Ig_3 250..323 CDD:464046 21/78 (27%)
4.1m 411..429 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.