DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-II and cadm4

DIOPT Version :10

Sequence 1:NP_001400995.1 Gene:side-II / 3346206 FlyBaseID:FBgn0259213 Length:1067 Species:Drosophila melanogaster
Sequence 2:XP_002939173.1 Gene:cadm4 / 100488420 XenbaseID:XB-GENE-992659 Length:394 Species:Xenopus tropicalis


Alignment Length:341 Identity:78/341 - (22%)
Similarity:144/341 - (42%) Gaps:69/341 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 RFNLSVIILPEQPIIMDRWGRQLNGTQLGPKQEGDDIVITCR--------VVGGRPQPQVRWLVN 214
            ||.|.:::|.....::.:..:..|.|.:    ||....|:|.        ||...|..|..:. |
 Frog    15 RFVLGIVLLATAGTVVSQEVQAENVTVV----EGGTAEISCHLHQYDGSIVVIQNPVRQTLFF-N 74

  Fly   215 G--LLVDNQNEHNSGDVIENRLLWPSVQRNDLNSVFTCQALNTQLDKPKEKS--------FILDM 269
            |  .|.|.:.:     ::|                ||.:.:...|...|.:.        :..|.
 Frog    75 GTRALKDTRFQ-----LVE----------------FTQKVVKIHLSDAKLEDEGGYFCQLYTEDT 118

  Fly   270 HLKPLVVKILEPPSSMIADRR--------YEVSCESSGSRPNAIITWYKGKRQLR--RTKDDISK 324
            |.:...:.::.||.:.:.:.:        .|::|.|..:||.|.:.||:.:::|:  .:|.:..|
 Frog   119 HHQIATLTVIVPPDNPLVEVKEQAVEGGEIELTCISPRTRPAATLRWYRDRKELKGFTSKQENGK 183

  Fly   325 N-STRSELSFVPTTDDDGKSITCRAENPNVNGLYLETMWKLNVVYPPLVTLRLGSTLTPDDIKEG 388
            . |..:.:.|.....||...:||.|.:|.:.|...:|.::|:|.:.|...::...:|    ::||
 Frog   184 TFSITNSIRFSVDRKDDRDIVTCEASHPALKGQKKQTQYELDVQFSPTANIQPSQSL----VREG 244

  Fly   389 DDVYFECHVQSNPQWRKLLW--LHNGIHLEHNTSARVIRSNQSLVLQKITKHYAGNYACSAINDE 451
            |::..:|.|..||:..:::|  |::.:.........|: |..||.||.     .|.|:|...|..
 Frog   245 DELNLKCEVTGNPRPTEIIWTRLNDSLPERAQIQGDVL-SFPSLSLQD-----NGTYSCQVSNKH 303

  Fly   452 GETVSNQLPLRVKYTP 467
            |.: |:|..| |.|.|
 Frog   304 GRS-SDQYVL-VVYDP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-IINP_001400995.1 V-set 55..163 CDD:462230 3/4 (75%)
Ig_3 190..254 CDD:464046 15/73 (21%)
Ig <292..366 CDD:472250 22/76 (29%)
Ig strand B 292..295 CDD:409418 1/2 (50%)
Ig strand C 305..309 CDD:409418 0/3 (0%)
Ig strand E 329..333 CDD:409418 0/3 (0%)
Ig strand F 343..348 CDD:409418 2/4 (50%)
Ig strand G 359..362 CDD:409418 1/2 (50%)
Ig 382..457 CDD:472250 20/76 (26%)
Ig strand B 391..395 CDD:409405 0/3 (0%)
Ig strand C 405..409 CDD:409405 1/5 (20%)
Ig strand E 428..432 CDD:409405 2/3 (67%)
Ig strand F 442..447 CDD:409405 2/4 (50%)
Ig 486..554 CDD:409353
Ig strand B 486..490 CDD:409353
Ig strand C 500..504 CDD:409353
Ig strand E 526..530 CDD:409353
Ig strand F 540..545 CDD:409353
cadm4XP_002939173.1 IgI_2_Necl-4 128..226 CDD:409468 24/97 (25%)
Ig strand A 128..131 CDD:409468 0/2 (0%)
Ig strand A' 134..138 CDD:409468 0/3 (0%)
Ig strand B 146..156 CDD:409468 3/9 (33%)
Ig strand C 159..168 CDD:409468 4/8 (50%)
Ig strand C' 169..172 CDD:409468 0/2 (0%)
Ig strand D 174..181 CDD:409468 1/6 (17%)
Ig strand E 184..194 CDD:409468 1/9 (11%)
Ig strand F 202..210 CDD:409468 3/7 (43%)
Ig strand G 218..225 CDD:409468 1/6 (17%)
Ig_3 230..301 CDD:464046 20/80 (25%)
4.1m 350..368 CDD:128590
Ig 37..127 CDD:472250 21/115 (18%)
Ig strand B 47..51 CDD:409353 1/3 (33%)
Ig strand C 60..64 CDD:409353 2/3 (67%)
Ig strand E 94..98 CDD:409353 0/3 (0%)
Ig strand F 108..113 CDD:409353 0/4 (0%)
Ig strand G 120..123 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.