DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIFa and SIFa

DIOPT Version :10

Sequence 1:NP_001246496.1 Gene:SIFa / 3346202 FlyBaseID:FBgn0053527 Length:72 Species:Drosophila melanogaster
Sequence 2:XP_308708.4 Gene:SIFa / 1270047 VectorBaseID:AGAMI1_013080 Length:75 Species:Anopheles gambiae


Alignment Length:72 Identity:41/72 - (56%)
Similarity:50/72 - (69%) Gaps:4/72 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALRFTLTLLLVTILVAAILLGSSEAAYRKPPFNGSIFGKR--NSLDYD-SAK-MSAVCEVAMEA 61
            ||....|..|:|.:||...|.|.:||.||||||||||||||  ||:||: :|| :|.:||:|.||
Mosquito     1 MASFKVLGSLIVVLLVVLALSGHAEAGYRKPPFNGSIFGKRNGNSVDYEGNAKVLSTMCEIAAEA 65

  Fly    62 CPMWFPQ 68
            |..||.|
Mosquito    66 CQSWFTQ 72

Return to query results.
Submit another query.