DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Unc-89 and Obsl1

DIOPT Version :9

Sequence 1:NP_001097440.1 Gene:Unc-89 / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:XP_006496646.2 Gene:Obsl1 / 98733 MGIID:2138628 Length:1896 Species:Mus musculus


Alignment Length:2219 Identity:456/2219 - (20%)
Similarity:803/2219 - (36%) Gaps:547/2219 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1123 PAFLVSLKDAEMIENTLFRFMVKIIGDPKPRVKFYKDEKEILETNDRIQIIRDKDYLGFYELVIA 1187
            |.||...:...::..........::|:|.|.|.:.|..:::: .::|:....|....|   |:::
Mouse    12 PCFLRFPRPVRVVSGAEAELKCVVLGEPPPTVVWEKGGQQLV-ASERLSFPEDGAEHG---LLLS 72

  Fly  1188 DVQKTDAGTYSCKATNKHGEANCEAIATTVEDKNP------------------------FGALSG 1228
            ....||||.|.|:|.|..|||...|..|.:|...|                        .|..|.
Mouse    73 GALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPAPEPEPESSECPLPTPGTGEGAPKFLTGPQSQ 137

  Fly  1229 QILPAGE-----------KPVFQWKRNGEEFD---PEERFKVLFG---EDED-SLALVFQHVKPE 1275
            .:|...|           :|...|:::|...|   ....||:..|   .||. ||.|.....:..
Mouse   138 WVLRGEEVVLTCQVGGLPEPKLYWEKDGMALDEVWDSSHFKLEPGRGASDEGASLTLRILAARLP 202

  Fly  1276 DAGIYTCVAQTSTGNISCSAELSVQGAIQTLNREP-EKPTLVIEHREAN-----ASIGGSAILEL 1334
            |:|:|.|.|:.:.|:....|.|.|....::..::| |.|..|:|..:..     .:.|..|....
Mouse   203 DSGVYVCHARNAHGHAQAGALLQVHQPRESPPQDPDENPKPVLEPLKGAPKTFWVNEGKHAKFRC 267

  Fly  1335 QCKGFPKPAVQWKHDGEVIQVDDRHKFMYEDEESMSLVIKNV--DTVDAGVYTIEAINELGQDES 1397
            ...|.|:|.::|..:|..: :.||.:.||.|.:. ..|:|.:  ...|.|:|...|.|..||..|
Mouse   268 YVMGKPEPEIEWHLEGRPL-LPDRRRLMYRDRDG-GFVLKVLYCQAKDRGLYVCAARNSAGQTLS 330

  Fly  1398 SINLVVKAPPK--IKKITDITCSAGETIKMEIEVEGFPQPTVQVTNNGKDVTAESNVKISSSSIG 1460
            ::.|.||.|..  .:.:.|:.......:.:|.:|.....||.....:.:.:......:|...::.
Mouse   331 AVQLHVKEPRLRFTRPLQDVEGREHGIVVLECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGAVR 395

  Fly  1461 KSLEKVVVEVKEIKLSQAGNYSIKATNDLSQTSEYWSCTVKSKPVIVKNFESEYIHGEKENVQMT 1525
            :      :.:.::|....|.|..:....:...:   :.|||..  |:|....:....|.||..:.
Mouse   396 R------LVIHKLKADDDGVYLCEMRGRVRTVA---NVTVKGP--ILKRLPRKLDVLEGENAVLL 449

  Fly  1526 VRIDAYPEAKL--TWYHDETEIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGSAT 1588
            |...   ||.:  .|..|..::..|    ..||.|:.:.|.:.|.||.|||:.|...    |::.
Mouse   450 VETQ---EAGVQGCWSRDGEDLPDT----CQSSCGHMHALVLPGVTREDAGEITFSL----GNSR 503

  Fly  1589 SSTQLLIKCA-------PEFTHKLKNITVAEGDSNVELVVGVDAYPRPHAKWYIDGIEIDEKRND 1646
            ::|.|.:||.       |......|      |..|..|:......|.|... :|..:|..|..:|
Mouse   504 TTTLLRVKCVKHSPPGPPVMVEMFK------GQKNKVLLTWKPPEPPPETS-FIYRLERQEVGSD 561

  Fly  1647 -----FRHVEEGNDFKLIMNQVATNMQGNYTCKI--MNDYGKL-------EDNCVVTVNCKPKVK 1697
                 | .:|:....::..:.|.|  :|:|..:|  ::::|:.       ..:.|.|.    ::.
Mouse   562 DWIQCF-SIEKAGAVEVPGDCVPT--EGDYHFRICTVSEHGRSPHVVFNGSAHLVPTA----RLV 619

  Fly  1698 RGLKNVEVQEGKS--FTLEVEVYSEPEAKIKWFKDGHEIYE---DARIKISRDTQRIE----NYY 1753
            .||::|:|.:|:.  |:|::....:.    .||.:|.::..   :.:::......|||    .:.
Mouse   620 SGLEDVQVYDGEDAVFSLDLSAIIQG----SWFLNGEQLQSNEPEGQVEPGALRYRIEQKGLQHR 680

  Fly  1754 LTLNLARTEDAGTYEMKATNFIGETTSTCKVAVLTSEALSLEQTVTKTLIATTEEPEEGAVPEIV 1818
            |.|...:..|:|.       .:|   .:|. .|..|.||:::::....|     .|::.......
Mouse   681 LILQAVKHRDSGA-------LVG---FSCP-GVQDSAALTIQESSVHIL-----SPQDKVSLTFT 729

  Fly  1819 HVDVFQQHSYESVPLKYEVIATGIPKPEAIWYHDGKPITPDKHTAITVDGDHYKLEVQSLDLVDA 1883
                    :.|.|.|..|:.....|   |.||.||:.:...:...:..:|..::|.:....:.|:
Mouse   730 --------TSERVVLTCELSRVDFP---ATWYKDGQKVEESESLIVKTEGRKHRLILPEAQVRDS 783

  Fly  1884 GEYKVVVQNKVGEKSHQGELSLSGIAEYRKPILTQGPGLKDIKVNKGDKVCEPVVFTADPAPEIV 1948
            ||:               |....|::.:                 .|..|.:|.|...:|...:.
Mouse   784 GEF---------------ECRTEGVSAF-----------------FGVTVQDPPVHIVNPQEHVF 816

  Fly  1949 LLKDGQPVVETNNVKL--KVDKKDA-----ENGLVQYTCTLNILEAEIKDSGRYELKVKNKYGEL 2006
            :     ..:.:..|:|  :||::|.     ::|            .|:::|....|:.|..:..|
Mouse   817 V-----HAITSECVRLTCEVDREDTTVHWYKDG------------QEVEESDIIVLENKGPHHRL 864

  Fly  2007 VTSGWIDVLAKPEISGLNDTKCLPGD---------TICFEALVQ--------------------- 2041
            |...     |:|...|  :.:|:.||         |..|..:|.                     
Mouse   865 VLPA-----ARPSDGG--EFQCVAGDERAYFTVTITDVFSWIVYPSSEVHVAAVRLERVVLTCEL 922

  Fly  2042 ANPKPKVSWTRGNENLCNHENCEVIADVDADKYRLVFQSVSPCEDGKYTITATNSEGRAAVDFNL 2106
            ..|..:|.||:..|.:.  |:..::.:.:....|||..||...:.|:| :...:.|   :..|.:
Mouse   923 CRPWAEVRWTKDGEEVV--ESPALLLEKEDTIRRLVLPSVQLEDSGEY-LCEIHDE---SASFTI 981

  Fly  2107 AVLVEKPTFIVQPESQSIHDYRPVSTKVLVHGVPLP----TIEWFKDDKPINYEAINKPGKDKLY 2167
            .| .|.|..|:.|:.:           |.:|.|.|.    |.|..::|.|:.:.      ||.|.
Mouse   982 TV-TEPPVRIIYPQDE-----------VTLHAVSLECVVLTCELSREDAPVRWY------KDGLE 1028

  Fly  2168 AKEDTK--KGTDQIESVLDIKSFRENDVGAYTCVATNEIGVTKAPFKLAMLSLAPSFVKKLDNAL 2230
            .:|...  ..:|.....|.:.:.:..|.|.:.|    :.|...|.|.:.:.:.....|.....:|
Mouse  1029 VEESEALVLQSDGPRRRLVLPAAQPEDGGEFVC----DAGDDSAFFTVTVTAPPERIVHPAARSL 1089

  Fly  2231 DVLQGEPLVLECCVDGSPLPT-VQWLKDGDEVKPSESIKISTNPDGLVK-LEINSCQPNDSGAYK 2293
            |:..|.|..:|...:.:|..: |:|.|||.||:.|:::::..  :|..: |.:...||.|:|.| 
Mouse  1090 DLQFGAPGHVELRCEVAPAGSQVRWYKDGLEVEVSDALQLGA--EGPARTLTLPHAQPEDAGEY- 1151

  Fly  2294 LIISNPHGEKVALCAVAVKPEEMQPKFLKPITSQT---VVVGEPLKLEAQVTGFPAPEVKWYKDG 2355
              :.....|.|..   .|...|:..:||.|..:..   ||.|||:.|..:::...| :|.|..:|
Mouse  1152 --VCETRDEAVTF---NVSLAELPVQFLAPEAAPNPLCVVPGEPVVLSCELSRASA-QVFWSHNG 1210

  Fly  2356 MLLRPSPEINFINSPNGQIGLIIDAAQPLDAGVYKCLIANKGGEIEGVSKVEI-VPKESKPVFVA 2419
            ..::....:. :.:...:..|.|.||.....|||.|    :.|...|...:.. |.....||.|.
Mouse  1211 SPVQQGEGLE-LRAEGPRRILCIQAADLAHTGVYTC----QSGASPGAPSLSFNVQVAEPPVRVV 1270

  Fly  2420 ELQDA-SSIEGFPVKMDIKVV---GNPKPKLQWFHNGHEIKPDASHIAI-VENPDNSSSLIIEKT 2479
            ..:.| :|:...| ..|:::|   ..|...::|:.:|..:   ||...: :|.......|.:...
Mouse  1271 APEAAQTSVRSTP-GGDLELVVHLSRPGTPVRWYKDGERL---ASQGRVQLEQAGARQVLRVRGA 1331

  Fly  2480 APGDSGLYEVIAQNPEGSTASKAKLYVAPKADETATEEAP--QFVSALRDVNADEGQELVLSAPF 2542
            ..||:|  |.:...|:.|     ::::      .:.||.|  :.||.|..:...||.:...... 
Mouse  1332 RRGDAG--EYLCDAPQDS-----RIFI------VSVEELPPVKLVSELTPLTVHEGDDATFQCE- 1382

  Fly  2543 ISNPMPEVIWSKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSSACNAN 2607
            :|.|..||.|.::|..:|...:|.|..:|....|.|:..:..|:|..|   |.....|:|| ..:
Mouse  1383 VSPPDAEVTWLRNGAVITAGPQLEMVQNGSSRTLIIRGCQLKDAGTVT---ARAGAADTSA-RLH 1443

  Fly  2608 VRKVYKPPVFTQKISDQQQVFGNNAKIPVTVSGV-PYPDLEWYFQDKPIPKSEKYSIKNDGDHHM 2671
            ||:.  ..:|.:::.|.:...|.:..:.|....| ....:.|....:|:|...:.:...||..|.
Mouse  1444 VRET--ELLFLRRLQDVRAEEGQDVHLEVETGRVGAAGTVRWIRGGEPLPLDSRLTTAQDGHVHR 1506

  Fly  2672 LIVNNCEKGDQGVYKCIASNREGKDITQGRLDI-VNEIKKHSRSEPPVFLKKIGDCDIYEGMVAK 2735
            |.::.....|||.|.|.:.:    |.|..||.: ..::::         |:.:.|..::||..|.
Mouse  1507 LSIHGVLLTDQGTYGCESRH----DRTLARLSVRPRQLRE---------LRPLEDVTVHEGGSAT 1558

  Fly  2736 F-----TACATGYPEPEVEWFKNDQKLFPSDRFLIDIEP-------NGL---------------- 2772
            |     ....||      ||.:...:|.|..:..|..|.       :||                
Mouse  1559 FQLELSQEGVTG------EWAQGGVRLHPGPKCHIQSEGRTHRLVLSGLGLADSGCVSFTADTLR 1617

  Fly  2773 --LRLTIK-------------NVTEYDVGRYSCRIFNPYGDDICHAELFYDSLDSQQKPLEDQYT 2822
              .|||::             .|||.|...:.|.:.....|.|                      
Mouse  1618 CAARLTVREVPVTIVQGPQDLEVTEGDTATFECELSQTLADVI---------------------- 1660

  Fly  2823 DFKKYKKSGAPPPLSEGPIISRMTDRGLLLSWNPSVPLTPRYPITYQIEMMDLPEGDWRTLR--- 2884
                ::|.|....||....:..:..|.|||                              ||   
Mouse  1661 ----WEKDGQALSLSPRLRLQALGTRRLLL------------------------------LRRCC 1691

  Fly  2885 ---TGVRSCACDIRNLEPFRDYRFRVRVENKFGVSDPSPYTQTYRQKLVPDPPKTYTYLPPGTDF 2946
               .|..||.......||.|                     .|.|::.|                
Mouse  1692 SSDAGTYSCVVGTARSEPAR---------------------LTVREREV---------------- 1719

  Fly  2947 RPETSPYFPKDFDIERPPHDGLAQAPQFLLREQD-ISYGVKDHNTEL--MWFVYGYPKPKMTYYF 3008
                               ..|.:......||.| .::......||:  .|.:.|          
Mouse  1720 -------------------SVLRELRSVSAREGDGATFECTVSETEITGRWELGG---------- 1755

  Fly  3009 DDMLIESGGRFDQSYTRNGQA-TLFINKMLDRDVG--WYEAVATNEHGEARQRVRLEIAEHPRFL 3070
              ..:..|||.  ...:.|:. .|.::::...|.|  .::|      |.|:...|||:...|..:
Mouse  1756 --RALRPGGRV--RIRQEGKKHILVLSELRTEDTGEVCFQA------GPAQSLARLEVEALPLQM 1810

  Fly  3071 KR--PDETFIMARKNGRIEAKLVGIPLPEVHWFKDWKPIVDSSRIKISSYDPDIYVLSIHDSIIK 3133
            .|  |.|..::..:...:|. .|..|...|.|.::...:...::.::..:. ..:.|.|||...:
Mouse  1811 CRRPPREKTVLVNRRAVLEV-TVSRPGGHVCWMREGVELCPGNKYEMRRHG-TTHSLVIHDVRPE 1873

  Fly  3134 DGGLYSISA 3142
            |.|.||..|
Mouse  1874 DQGTYSCQA 1882

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Unc-89NP_001097440.1 RhoGEF 90..260 CDD:238091
PH_unc89 275..388 CDD:270134
Atrophin-1 <493..690 CDD:331285
TonB_N 502..>596 CDD:318287
I-set 1017..1108 CDD:333254
I-set 1123..1212 CDD:254352 23/88 (26%)
I-set <1236..1299 CDD:333254 20/69 (29%)
I-set 1313..1403 CDD:254352 26/96 (27%)
Ig_3 1406..1487 CDD:316449 10/82 (12%)
I-set 1499..1595 CDD:254352 28/97 (29%)
I-set 1599..1690 CDD:333254 20/104 (19%)
I-set 1694..1786 CDD:254352 19/100 (19%)
I-set <1836..1903 CDD:333254 12/66 (18%)
I-set 1922..2005 CDD:333254 15/89 (17%)
I-set 2018..2108 CDD:333254 23/119 (19%)
I-set 2113..2214 CDD:333254 23/106 (22%)
I-set 2220..2302 CDD:254352 22/83 (27%)
I-set 2318..2408 CDD:254352 23/92 (25%)
I-set 2415..2506 CDD:254352 21/95 (22%)
I-set 2519..2608 CDD:254352 25/90 (28%)
I-set 2615..2696 CDD:254352 17/81 (21%)
I-set 2717..2805 CDD:254352 26/130 (20%)
FN3 2834..2925 CDD:238020 14/96 (15%)
I-set <2996..3063 CDD:333254 13/69 (19%)
I-set 3067..3157 CDD:333254 18/78 (23%)
PK_Unc-89_rpt1 3182..3440 CDD:271011
I-set 3654..3744 CDD:333254
FN3 3748..3840 CDD:238020
STKc_Unc-89_rpt2 3893..4151 CDD:271014
Obsl1XP_006496646.2 I-set 12..88 CDD:400151 19/79 (24%)
Ig strand B 29..33 CDD:409353 0/3 (0%)
Ig strand C 42..46 CDD:409353 1/3 (33%)
Ig strand E 67..71 CDD:409353 2/6 (33%)
Ig strand F 81..86 CDD:409353 2/4 (50%)
IG 134..226 CDD:214652 23/91 (25%)
Ig strand A' 252..257 CDD:409353 0/4 (0%)
Ig 257..336 CDD:416386 23/80 (29%)
Ig strand B 262..269 CDD:409353 1/6 (17%)
Ig strand C 276..282 CDD:409353 1/5 (20%)
Ig strand C' 283..286 CDD:409353 1/2 (50%)
Ig strand D 292..298 CDD:409353 2/5 (40%)
Ig strand E 301..311 CDD:409353 2/9 (22%)
Ig strand F 315..323 CDD:409353 3/7 (43%)
Ig strand G 325..336 CDD:409353 4/10 (40%)
Ig 342..426 CDD:416386 9/92 (10%)
Ig strand B 358..362 CDD:409353 0/3 (0%)
Ig strand C 371..374 CDD:409353 1/2 (50%)
Ig strand E 395..399 CDD:409353 0/9 (0%)
Ig strand F 409..414 CDD:409353 1/4 (25%)
Ig strand G 423..426 CDD:409353 0/2 (0%)
FN3 518..602 CDD:238020 19/93 (20%)
Ig 736..801 CDD:416386 16/99 (16%)
Ig strand C 746..751 CDD:409353 3/7 (43%)
Ig strand C' 754..757 CDD:409353 0/2 (0%)
Ig strand D 762..767 CDD:409353 0/4 (0%)
Ig strand E 770..775 CDD:409353 1/4 (25%)
Ig strand F 784..790 CDD:409353 3/20 (15%)
Ig strand G 793..801 CDD:409353 1/24 (4%)
Ig 825..892 CDD:416386 18/85 (21%)
Ig strand B 825..830 CDD:409353 2/4 (50%)
Ig strand C 837..842 CDD:409353 0/4 (0%)
Ig strand C' 845..848 CDD:409353 1/2 (50%)
Ig strand D 853..858 CDD:409353 1/4 (25%)
Ig strand E 861..866 CDD:409353 1/4 (25%)
Ig strand F 875..881 CDD:409353 2/7 (29%)
Ig strand G 884..892 CDD:409353 0/7 (0%)
Ig 918..983 CDD:416386 15/70 (21%)
Ig strand C 928..933 CDD:409353 2/4 (50%)
Ig strand C' 936..939 CDD:409353 1/2 (50%)
Ig strand D 944..949 CDD:409353 0/4 (0%)
Ig strand E 952..957 CDD:409353 2/4 (50%)
Ig strand F 966..972 CDD:409353 2/6 (33%)
Ig strand G 975..983 CDD:409353 2/10 (20%)
Ig 1009..1074 CDD:416386 16/74 (22%)
Ig strand C 1019..1024 CDD:409353 1/10 (10%)
Ig strand C' 1027..1030 CDD:409353 1/2 (50%)
Ig strand D 1035..1040 CDD:409353 0/4 (0%)
Ig strand E 1043..1048 CDD:409353 1/4 (25%)
Ig strand F 1057..1063 CDD:409353 2/9 (22%)
Ig strand G 1066..1074 CDD:409353 2/7 (29%)
Ig 1096..1166 CDD:416386 21/77 (27%)
Ig strand B 1099..1104 CDD:409353 1/4 (25%)
Ig strand C 1111..1116 CDD:409353 2/4 (50%)
Ig strand C' 1119..1122 CDD:409353 1/2 (50%)
Ig strand D 1127..1132 CDD:409353 0/6 (0%)
Ig strand E 1135..1140 CDD:409353 1/4 (25%)
Ig strand F 1149..1155 CDD:409353 2/8 (25%)
Ig strand G 1158..1166 CDD:409353 3/10 (30%)
Ig 1179..1265 CDD:416386 21/91 (23%)
Ig strand A 1179..1184 CDD:409353 0/4 (0%)
Ig strand B 1188..1196 CDD:409353 4/7 (57%)
Ig strand C 1202..1208 CDD:409353 3/6 (50%)
Ig strand C' 1210..1213 CDD:409353 1/2 (50%)
Ig strand D 1218..1222 CDD:409353 0/4 (0%)
Ig strand E 1228..1235 CDD:409353 2/6 (33%)
Ig strand F 1241..1250 CDD:409353 5/12 (42%)
Ig strand G 1252..1265 CDD:409353 2/12 (17%)
Ig 1273..1354 CDD:416386 18/97 (19%)
Ig strand A 1273..1275 CDD:409353 0/1 (0%)
Ig strand A' 1278..1282 CDD:409353 1/3 (33%)
Ig strand B 1286..1292 CDD:409353 2/5 (40%)
Ig strand C 1299..1304 CDD:409353 1/4 (25%)
Ig strand C' 1307..1310 CDD:409353 0/5 (0%)
Ig strand D 1315..1320 CDD:409353 1/4 (25%)
Ig strand E 1323..1328 CDD:409353 1/4 (25%)
Ig strand F 1337..1343 CDD:409353 2/7 (29%)
Ig strand G 1346..1354 CDD:409353 1/18 (6%)
Ig 1361..1444 CDD:416386 24/87 (28%)
Ig strand B 1376..1383 CDD:409353 0/7 (0%)
Ig strand C 1389..1395 CDD:409353 3/5 (60%)
Ig strand C' 1396..1399 CDD:409353 1/2 (50%)
Ig strand D 1405..1410 CDD:409353 2/4 (50%)
Ig strand E 1413..1423 CDD:409353 2/9 (22%)
Ig strand G 1433..1444 CDD:409353 3/11 (27%)
Ig 1451..1522 CDD:416386 16/70 (23%)
Ig strand A' 1458..1461 CDD:409353 0/2 (0%)
Ig strand B 1465..1471 CDD:409353 0/5 (0%)
Ig strand C 1480..1485 CDD:409353 1/4 (25%)
Ig strand C' 1488..1491 CDD:409353 1/2 (50%)
Ig strand D 1496..1501 CDD:409353 0/4 (0%)
Ig strand E 1504..1509 CDD:409353 2/4 (50%)
Ig strand F 1518..1524 CDD:409353 3/5 (60%)
Ig strand G 1527..1535 CDD:409353 4/7 (57%)
Ig 1543..1624 CDD:416386 18/86 (21%)
Ig strand A' 1549..1552 CDD:409353 0/2 (0%)
Ig strand B 1556..1562 CDD:409353 2/5 (40%)
Ig strand C 1569..1574 CDD:409353 4/10 (40%)
Ig strand C' 1577..1580 CDD:409353 0/2 (0%)
Ig strand D 1585..1590 CDD:409353 1/4 (25%)
Ig strand E 1593..1598 CDD:409353 0/4 (0%)
Ig strand F 1607..1613 CDD:409353 0/5 (0%)
Ig strand G 1616..1624 CDD:409353 2/7 (29%)
Ig 1631..1714 CDD:416386 23/159 (14%)
Ig strand B 1645..1651 CDD:409353 0/5 (0%)
Ig strand C 1658..1663 CDD:409353 2/30 (7%)
Ig strand C' 1666..1669 CDD:409353 0/2 (0%)
Ig strand D 1674..1679 CDD:409353 0/4 (0%)
Ig strand E 1682..1687 CDD:409353 4/34 (12%)
Ig strand F 1696..1702 CDD:409353 3/5 (60%)
Ig 1720..1803 CDD:416386 20/102 (20%)
Ig strand A' 1725..1730 CDD:409353 0/4 (0%)
Ig strand B 1735..1742 CDD:409353 0/6 (0%)
Ig strand C 1746..1754 CDD:409353 2/7 (29%)
Ig strand C' 1755..1758 CDD:409353 1/14 (7%)
Ig strand D 1764..1769 CDD:409353 0/6 (0%)
Ig strand E 1772..1782 CDD:409353 1/9 (11%)
Ig strand G 1792..1803 CDD:409353 5/16 (31%)
IG_like 1815..1893 CDD:214653 16/70 (23%)
Ig strand B 1826..1830 CDD:409353 0/3 (0%)
Ig strand C 1838..1842 CDD:409353 1/3 (33%)
Ig strand E 1863..1867 CDD:409353 1/3 (33%)
Ig strand F 1877..1882 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10426
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100287
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.