DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obsc and OBSCN

DIOPT Version :10

Sequence 1:NP_001097440.1 Gene:Obsc / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:NP_001373054.1 Gene:OBSCN / 84033 HGNCID:15719 Length:8925 Species:Homo sapiens


Alignment Length:4699 Identity:881/4699 - (18%)
Similarity:1435/4699 - (30%) Gaps:1767/4699 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   922 RRYETKTRDYDR------GTSYDSTV------ERSQYGISSRRDRSS---------------VDK 959
            |:.....:|.||      |||.:..:      :..:|.....::|:|               |..
Human  4527 RKGPNTLKDGDRYSLKQDGTSCELQIRGLVIADAGEYSCICEQERTSATLTVRALPARFIEDVRN 4591

  Fly   960 VEARSSLLATGRTESRAASRAESRAESRA-----SYSVAESRAGIRSSSRLQ----EDR------ 1009
            .||.....|..:.|...|:..|.|..|..     .||:.:.  |.|...:::    ||.      
Human  4592 HEATEGATAVLQCELSKAAPVEWRKGSETLRDGDRYSLRQD--GTRCELQIRGLAVEDTGEYLCV 4654

  Fly  1010 ---------------PLRSVDKPVVVKMLKSVQVEPGETA--HFEIQFKDQPGLVTWLKDNKPLE 1057
                           |.|.:|.      :.:.:...|.||  |.|:. |..|  |.|.|..:.|.
Human  4655 CGQERTSATLTVRALPARFIDN------MTNQEAREGATATLHCELS-KVAP--VEWRKGPETLR 4710

  Fly  1058 DRLADRITQTAAPMNSYR-------LDIKNCSETDAGTYTIRAQSASETTTVSAQLAVGQAPGHD 1115
            |  .||        :|.|       |.|:..|..|||.|:  .....|.|  ||.|.:...|.  
Human  4711 D--GDR--------HSLRQDGTRCELQIRGLSVADAGEYS--CVCGQERT--SATLTIRALPA-- 4759

  Fly  1116 ETKTNTEPAFLVSLKDAEMIENTLFRFMVKIIGDPKPRVKFYKDEKEILETNDRIQIIRDKDYLG 1180
                    .|...|::.|..|........::   .|.....::...|.|...||..:.:|.... 
Human  4760 --------KFTKGLRNEEATEGATAMLQCEL---SKVAPVEWRKGPETLRDGDRYNLRQDGTRC- 4812

  Fly  1181 FYELVIADVQKTDAGTYSCKATNKHGEANCEAIATTVEDKNPFGALSGQILPAGEKPVFQ----- 1240
              ||.|..:...|.|.|||....:...|.....|.....:.|..:|..:   .|.....|     
Human  4813 --ELQIHGLSVADTGEYSCVCGQEKTSATLTVKAPQPVFREPLQSLQAE---EGSTATLQCELSE 4872

  Fly  1241 ------WKRNGEEFDPEERFKVLFGEDEDSL-----ALVFQHVKPEDAGIYTCVAQTSTGNISCS 1294
                  |.:.|.:....       |..|..|     .||.|.::.||.|.|||    :.|:.:.|
Human  4873 PTATVVWSKGGLQLQAN-------GRREPRLQGCTAELVLQDLQREDTGEYTC----TCGSQATS 4926

  Fly  1295 AELSVQGAIQTLNREPEKPTLVIEHREANASIGGSAIL--ELQCKGFPKPAVQWKHDGEVIQVDD 1357
            |.|:|..|.....||       ::|:|.:.  ||:|.|  ||...|   .:|:|:...  :|:..
Human  4927 ATLTVTAAPVRFLRE-------LQHQEVDE--GGTAHLCCELSRAG---ASVEWRKGS--LQLFP 4977

  Fly  1358 RHKF-MYEDEESMSLVIKNVDTVDAGVYTIEAINELGQDESSINLVVKAP-PKIK-KITDITCSA 1419
            ..|: |.:|..:..|:::.|:..|||.||.:.    |..:|..:|.|:.| ||.| ::..:....
Human  4978 CAKYQMVQDGAAAELLVRGVEQEDAGDYTCDT----GHTQSMASLSVRVPRPKFKTRLQSLEQET 5038

  Fly  1420 GETIKMEIEV-EGFPQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSI 1483
            |:..::..:: :......||....|.::.|....::.|....:.|     .:.:::....|.|:.
Human  5039 GDIARLCCQLSDAESGAVVQWLKEGVELHAGPKYEMRSQGATREL-----LIHQLEAKDTGEYAC 5098

  Fly  1484 -----KATNDLSQTSEYWSCTVKSKPVIVKNFESEYIHGEKENVQMTVRIDAYPEAKLTWYHDET 1543
                 |....|..|        :.:..||:......:..: |:|:.:..:.......:.|.....
Human  5099 VTGGQKTAASLRVT--------EPEVTIVRGLVDAEVTAD-EDVEFSCEVSRAGATGVQWCLQGL 5154

  Fly  1544 EIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQLLIKCAPEFTHKLKNI 1608
            .::..:.......||..:||::.|.|..|||..:...    |:..||.||.:: |||       :
Human  5155 PLQSNEVTEVAVRDGRIHTLRLKGVTPEDAGTVSFHL----GNHASSAQLTVR-APE-------V 5207

  Fly  1609 TVAEGDSNVELVVGVDA--------YPRPHAKWYIDGIEID-EKRNDFRHVEEGNDFKLIMNQVA 1664
            |:.|...:|:|..|.||        .....|:|.:.|:.:. .:.||.. ||:|....|.:::|.
Human  5208 TILEPLQDVQLSEGQDASFQCRLSRASGQEARWALGGVPLQANEMNDIT-VEQGTLHLLTLHKVT 5271

  Fly  1665 TNMQGNYTCKIMNDYGKLEDNCVVTVNCKPKVKRGLKNVEVQEGKSFTLEVEVYSEPE-AKIKWF 1728
            ....|..:..:    |.......:.|..|..|.|||:|||..||.....|.:: |:|| |...|.
Human  5272 LEDAGTVSFHV----GTCSSEAQLKVTAKNTVVRGLENVEALEGGEALFECQL-SQPEVAAHTWL 5331

  Fly  1729 KDGHEIY--EDARIKISRDTQRIENYYLTLNLARTEDAGTYEMKATNFIGETTSTCKVAVLTSEA 1791
            .|...::  |:|.:....:..|   :.|.|...|.:|                 :|:|..|..: 
Human  5332 LDDEPVHTSENAEVVFFENGLR---HLLLLKNLRPQD-----------------SCRVTFLAGD- 5375

  Fly  1792 LSLEQTVTKTLIATTEEPEEGAVPEIVHVDVFQQHSYESVPLKYEVIATG------------IPK 1844
                 .||...:..     .|...||:.            |||...:..|            :|.
Human  5376 -----MVTSAFLTV-----RGWRLEILE------------PLKNAAVRAGAQACFTCTLSEAVPV 5418

  Fly  1845 PEAIWYHDGKPITP-DKHTAITVDGDHYKLEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSLSGI 1908
            .||.||.:|..:.| |....:|.||.|:.|.::|.....|||.....::.|.    ...|::.|:
Human  5419 GEASWYINGAAVQPDDSDWTVTADGSHHALLLRSAQPHHAGEVTFACRDAVA----SARLTVLGL 5479

  Fly  1909 AE------------------YRKPILTQGPGL--KDIKVNKGD----KVCEPVVFTADPAPEIVL 1949
            .:                  :..|:...|.||  ..::|.:|.    ::|..:|    |.||.|:
Human  5480 PDPPEDAEVVARSSHTVTLSWAAPMSDGGGGLCGYRVEVKEGATGQWRLCHELV----PGPECVV 5540

  Fly  1950 ------------------LKDGQPVVETNNVKLKVDKKD-------------------------- 1970
                              :..|:||.....|:|....|.                          
Human  5541 DGLAPGETYRFRVAAVGPVGAGEPVHLPQTVRLAEPPKPVPPQPSAPESRQVAAGEDVSLELEVV 5605

  Fly  1971 AENGLVQYTCTLNILEAEIKDSGRYELKVKNKYGELVTSGWIDVLAKPEISGLNDTKC-LPGDTI 2034
            ||.|.|.:...:.    .|:..||:|:..:.:...||..|:     ..|..|  :..| |...:|
Human  5606 AEAGEVIWHKGME----RIQPGGRFEVVSQGRQQMLVIKGF-----TAEDQG--EYHCGLAQGSI 5659

  Fly  2035 C-----FE-----ALVQANPKPKVSWTRGNENLCNHENCEVIADVDADKYRL----VFQSVS--P 2083
            |     |:     |.|...|:|.:......|.     :..::.:..|.|.|:    ...|:|  |
Human  5660 CPAAATFQVALSPASVDEAPQPSLPPEAAQEG-----DLHLLWEALARKRRMSREPTLDSISELP 5719

  Fly  2084 CEDGK------------------YTI--------------TATNSEGRAAVDFNLAVLVEKPTFI 2116
            .|||:                  |:.              |:::.|.||..          |:.:
Human  5720 EEDGRSQRLPQEAEEVAPDLSEGYSTADELARTGDADLSHTSSDDESRAGT----------PSLV 5774

  Fly  2117 VQPESQSIHDYRPVSTKVLVHGVP-LPTIEWFKDDKPINYEAINKPGKDKLYAKE----DTKKGT 2176
            ...:........|:::||   |.| .|:::..:..:|:   |..:|....|..|:    ...|..
Human  5775 TYLKKAGRPGTSPLASKV---GAPAAPSVKPQQQQEPL---AAVRPPLGDLSTKDLGDPSMDKAA 5833

  Fly  2177 DQIESVL-------DIKSFRENDVGAYTCVATNEIGVTKAPFKLAMLSLAPSFVKKLDNALDVLQ 2234
            .:|::..       ::|. :|..:.::|      .|.|:|..                       
Human  5834 VKIQAAFKGYKVRKEMKQ-QEGPMFSHT------FGDTEAQV----------------------- 5868

  Fly  2235 GEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPNDSGAYKLIISNP 2299
            |:.|.|||.|........:|||||.|:.......|....||...|.|......|:|.|...:||.
Human  5869 GDALRLECVVASKADVRARWLKDGVELTDGRHHHIDQLGDGTCSLLITGLDRADAGCYTCQVSNK 5933

  Fly  2300 HGEKVALCAVAVKPEEMQPKFLKPITSQTVVVGEPLKLEAQ------VTGFPAPEVKWYKDGMLL 2358
            .|:......|.|...|.:.:     :|....:.:..:..|:      .|..|| ||         
Human  5934 FGQVTHSACVVVSGSESEAE-----SSSGGELDDAFRRAARRLHRLFRTKSPA-EV--------- 5983

  Fly  2359 RPSPEINFINSPNGQIGLIIDAAQPLDAGVYK------C------------------LIANKGGE 2399
              |.|..|:::..|.    .:..:|.|...|:      |                  :.|..|..
Human  5984 --SDEELFLSADEGP----AEPEEPADWQTYREDEHFICIRFEALTEARQAVTRFQEMFATLGIG 6042

  Fly  2400 IE------GVSKVE----------IVPKE---------SKPVFVAELQDASSIEGFPVKMDIKVV 2439
            :|      |..:||          :||.|         :.|||:.|||:....:|:||..|..|.
Human  6043 VEIKLVEQGPRRVEMCISKETPAPVVPPEPLPSLLTSDAAPVFLTELQNQEVQDGYPVSFDCVVT 6107

  Fly  2440 GNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKL 2504
            |.|.|.::||.:|..::.| .|..|.|:......|||....|.|.|:|..:|:|..|.:::||:|
Human  6108 GQPMPSVRWFKDGKLLEED-DHYMINEDQQGGHQLIITAVVPADMGVYRCLAENSMGVSSTKAEL 6171

  Fly  2505 YV-----------------------------APKADETATEEA--PQFVSALRDVNADEGQELV- 2537
            .|                             ..:..|:.|:|.  ||.|..|||:....|..|. 
Human  6172 RVDLTSTDYDTAADATESSSYFSAQGYLSSREQEGTESTTDEGQLPQVVEELRDLQVAPGTRLAK 6236

  Fly  2538 LSAPFISNPMPEVIWSKDGVTLTPNERLLMTCDGKHI-GLTIKPAEAADSGNYTCLLANPLGEDS 2601
            ........|.|.:.|.|||..||.:..:.|| |.|.: .|.|......|||.|...::|.:|...
Human  6237 FQLKVKGYPAPRLYWFKDGQPLTASAHIRMT-DKKILHTLEIISVTREDSGQYAAYISNAMGAAY 6300

  Fly  2602 SACN--------------ANVRKVYKPPVFTQKISDQQQVFGNNAKIPVTVSGVPYPDLEWYFQD 2652
            |:..              ::|.:...||...::.:.::...|::....|.|.|.|.|.:.|..::
Human  6301 SSARLLVRGPDEPEEKPASDVHEQLVPPRMLERFTPKKVKKGSSITFSVKVEGRPVPTVHWLREE 6365

  Fly  2653 KPI------PKSEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGK---------------- 2695
            ...      |.:..|::.:....|.|::.:..:..||.|.|||||..|:                
Human  6366 AERGVLWIGPDTPGYTVASSAQQHSLVLLDVGRQHQGTYTCIASNAAGQALCSASLHVSGLPKVE 6430

  Fly  2696 ----------------------------------------------------------------- 2695
                                                                             
Human  6431 EQEKVKEALISTFLQGTTQAISAQGLETASFADLGGQRKEEPLAAKEALGHLSLAEVGTEEFLQK 6495

  Fly  2696 -----------DITQGRLDI-----------VNEIKKHSRSEPPVFLKKI------GDC-----D 2727
                       .|||.:|.:           .:...:|.||.|...:::.      ||.     |
Human  6496 LTSQITEMVSAKITQAKLQVPGGDSDEDSKTPSASPRHGRSRPSSSIQESSSESEDGDARGEIFD 6560

  Fly  2728 IY-------------------EGMV------------------AKFTACATGYPEP--------- 2746
            ||                   ||..                  .|.:....|:..|         
Human  6561 IYVVTADYLPLGAEQDAITLREGQYVEVLDAAHPLRWLVRTKPTKSSPSRQGWVSPAYLDRRLKL 6625

  Fly  2747 EVEWFKNDQKLFPSD-----------------------------RFL-------------IDIEP 2769
            ..||...:...||.:                             :||             :.|..
Human  6626 SPEWGAAEAPEFPGEAVSEDEYKARLSSVIQELLSSEQAFVEELQFLQSHHLQHLERCPHVPIAV 6690

  Fly  2770 NGLLRLTIKNVTEYDVGRYSCRIFNPY-----GDDIC------------HAELFYDSLDSQQKPL 2817
            .|...:..:||.  |:||:........     .||:.            :.|.....:.::...:
Human  6691 AGQKAVIFRNVR--DIGRFHSSFLQELQQCDTDDDVAMCFIKNQAAFEQYLEFLVGRVQAESVVV 6753

  Fly  2818 EDQYTDF-KKYKKSG---------APPPLS---EGPIISRMTDRGLL------------------ 2851
            .....:| |||.:..         .||||.   |.|:......:.||                  
Human  6754 STAIQEFYKKYAEEALLAGDPSQPPPPPLQHYLEQPVERVQRYQALLKELIRNKARNRQNCALLE 6818

  Fly  2852 -----LSWNPS-------VPLTPRYPITYQI---------------------------------- 2870
                 :|..|.       |.|...||.|.|.                                  
Human  6819 QAYAVVSALPQRAENKLHVSLMENYPGTLQALGEPIRQGHFIVWEGAPGARMPWKGHNRHVFLFR 6883

  Fly  2871 --EMMDLPEGDWRT------LRTGVRSCACDIRNLEPFRDYRFRVRVENKFGVSDPSPYTQT--- 2924
              .::..|..|.||      .|..::..:.|:.:.....|..|.|..|.:..|.......:|   
Human  6884 NHLVICKPRRDSRTDTVSYVFRNMMKLSSIDLNDQVEGDDRAFEVWQEREDSVRKYLLQARTAII 6948

  Fly  2925 ----------YRQKL-VPDPPKTYTYLPPGTDFRPETS------------------------PYF 2954
                      .:|:| :|      .:.||  ||..|.:                        .::
Human  6949 KSSWVKEICGIQQRLALP------VWRPP--DFEEELADCTAELGETVKLACRVTGTPKPVISWY 7005

  Fly  2955 PKDFDIERPPH-------DG----------------------------------LAQAPQFLLRE 2978
            .....::..||       ||                                  |.|.|...:.:
Human  7006 KDGKAVQVDPHHILIEDPDGSCALILDSLTGVDSGQYMCFAASAAGNCSTLGKILVQVPPRFVNK 7070

  Fly  2979 QDISYGVKDHNTELMWFVYGYPKPKMTYYFDDMLIESGGRFDQ-SYTRNGQATLFINKMLDRDVG 3042
            ...|..|:..:.:....:.|.|.|::.:|.|..|:.:|.:|.. |..|:|...|.|......|:|
Human  7071 VRASPFVEGEDAQFTCTIEGAPYPQIRWYKDGALLTTGNKFQTLSEPRSGLLVLVIRAASKEDLG 7135

  Fly  3043 WYEAVATNEHGEARQRVRLEI-------------------------------------------- 3063
            .||....|..|.||....|.|                                            
Human  7136 LYECELVNRLGSARASAELRIQSPMLQAQEQCHREQLVAAVEDTTLERADQEVTSVLKRLLGPKA 7200

  Fly  3064 ----------------------------------------------------AEHPRFLKRPDET 3076
                                                                .:.|..:.|..|.
Human  7201 PGPSTGDLTGPGPCPRGAPALQETGSQPPVTGTSEAPAVPPRVPQPLLHEGPEQEPEAIARAQEW 7265

  Fly  3077 FIMARKNG--------------------------------------------------------- 3084
            .:..|..|                                                         
Human  7266 TVPIRMEGAAWPGAGTGELLWDVHSHVVRETTQRTYTYQAIDTHTARPPSMQVTIEDVQAQTGGT 7330

  Fly  3085 -RIEAKLVGIPLPEVHWFKDWKPIVDSSRIKISSYDPDIYVLSIHDSIIKDGGLYSISARNIAGS 3148
             :.||.:.|.|.|.|.|:||...:|||:|:. ...:...|.|.:.....||.|:|:..|:|..|.
Human  7331 AQFEAIIEGDPQPSVTWYKDSVQLVDSTRLS-QQQEGTTYSLVLRHVASKDAGVYTCLAQNTGGQ 7394

  Fly  3149 I--STSVTVHIEENEDQYIYKTYGR--HPYVRSKQLRYQDKYDIGDELGRGTQGITYHAVERSSG 3209
            :  ...:.|...:||.....:::.|  |.:           |::.:|:|||..|.......:.:.
Human  7395 VLCKAELLVLGGDNEPDSEKQSHRRKLHSF-----------YEVKEEIGRGVFGFVKRVQHKGNK 7448

  Fly  3210 DNYAAKIMYGRPELRPFMLNELEMMNTFNHKNLIRPYDAYDTDRSVTLIMELAAGGELVRDNLLR 3274
            ...|||.:..|...|.....|.:::...:|..:....|.::|.:::.||:||.:..||: |.|.|
Human  7449 ILCAAKFIPLRSRTRAQAYRERDILAALSHPLVTGLLDQFETRKTLILILELCSSEELL-DRLYR 7512

  Fly  3275 RDYYTERDIAHYIRQTLWGLEHMHEMGVGHMGLTIKDLLISVVGGDIIKVSDFGLSRKINRHNLS 3339
            :...||.::..||:|.:.||.::|..||.|:.:...::|:.....:.||:.|||.::.|....|.
Human  7513 KGVVTEAEVKVYIQQLVEGLHYLHSHGVLHLDIKPSNILMVHPAREDIKICDFGFAQNITPAELQ 7577

  Fly  3340 TLDYGMPEFVSPEVVNKEGVNFSHDMWTVGLITYVLLGGHNPFLGIDDRETLTKIREGRWDFKDE 3404
            ...||.|||||||::.:..|:.:.|:|.:|:|:|:.|...:||.|..||.||..:.|||..:...
Human  7578 FSQYGSPEFVSPEIIQQNPVSEASDIWAMGVISYLSLTCSSPFAGESDRATLLNVLEGRVSWSSP 7642

  Fly  3405 IWTHISDDGRDFISRLLLYSPEERMDVKTALKHPWF------------------FMLDRPVYDHD 3451
            :..|:|:|.:|||...|..:|:.|......|.||||                  |:|.|..:...
Human  7643 MAAHLSEDAKDFIKATLQRAPQARPSAAQCLSHPWFLKSMPAEEAHFINTKQLKFLLARSRWQRS 7707

  Fly  3452 Y-----------------------QIGTDRLRNYYDHF-RDWYANASCKN--------YFRRRRL 3484
            .                       .:|..|      |. ||...::|..:        :.|.:.|
Human  7708 LMSYKSILVMRSIPELLRGPPDSPSLGVAR------HLCRDTGGSSSSSSSSDNELAPFARAKSL 7766

  Fly  3485 ---------------------------------------------------SGC----------F 3488
                                                               .||          |
Human  7767 PPSPVTHSPLLHPRGFLRPSASLPEEAEASERSTEAPAPPASPEGAGPPAAQGCVPRHSVIRSLF 7831

  Fly  3489 QH-----PSKMVYPPG---------HV----YTPENTP---EPLPEPRI---RAKREE---VVSK 3526
            .|     |......||         |:    |.....|   |||.|.|:   .|.|||   :::|
Human  7832 YHQAGESPEHGALAPGSRRHPARRRHLLKGGYIAGALPGLREPLMEHRVLEEEAAREEQATLLAK 7896

  Fly  3527 YLHPDYE--LGLIQSESHYQYG------------------------------------------- 3546
              .|.:|  |.|..|.:|...|                                           
Human  7897 --APSFETALRLPASGTHLAPGHSHSLEHDSPSTPRPSSEACGEAQRLPSAPSGGAPIRDMGHPQ 7959

  Fly  3547 ---------------------PDT----------------------------------------- 3549
                                 ||:                                         
Human  7960 GSKQLPSTGGHPGTAQPERPSPDSPWGQPAPFCHPKQGSAPQEGCSPHPAVAPCPPGSFPPGSCK 8024

  Fly  3550 ---------YLLQLR-------------------DVNFPVRLRE--------------------- 3565
                     :|.|.:                   |::.|.|.:.                     
Human  8025 EAPLVPSSPFLGQPQAPPAPAKASPPLDSKMGPGDISLPGRPKPGPCSSPGSASQASSSQVSSLR 8089

  Fly  3566 --YMKVAHRRSPSFALNDSVDW---------SLPVIRE------RRRFT---------------- 3597
              ..:|.....||.   |:..|         |.|.::.      .|:|:                
Human  8090 VGSSQVGTEPGPSL---DAEGWTQEAEDLSDSTPTLQRPQEQATMRKFSLGGRGGYAGVAGYGTF 8151

  Fly  3598 ------------------------------------DIMDEEIDDERTRSRISMYAA-------- 3618
                                                :...||..:.|..|.:...:|        
Human  8152 AFGGDAGGMLGQGPMWARIAWAVSQSEEEEQEEARAESQSEEQQEARAESPLPQVSARPVPEVGR 8216

  Fly  3619 --------------------------------------------------NESYSIRRL------ 3627
                                                              ::.|.|:.|      
Human  8217 APTRSSPEPTPWEDIGQVSLVQIRDLSGDAEAADTISLDISEVDPAYLNLSDLYDIKYLPFEFMI 8281

  Fly  3628 -------------------------------RTELGPR-----LDEYTEADAMIE---------- 3646
                                           ..||||.     .:|..:.||::.          
Human  8282 FRKVPKSAQPEPPSPMAEEELAEFPEPTWPWPGELGPHAGLEITEESEDVDALLAEAAVGRKRKW 8346

  Fly  3647 ----------------------------------------------TQREGYPPFFREKP----- 3660
                                                          .::|| ||  |:||     
Human  8347 SSPSRSLFHFPGRHLPLDEPAELGLRERVKASVEHISRILKGRPEGLEKEG-PP--RKKPGLASF 8408

  Fly  3661 --------------------QTIAITENQPSHIHCFAVGDPKPCVQWFKNDMVLTESKRIKISVD 3705
                                :|:.:  .|...:.|.....|.....|.|:...|..|.|:.||..
Human  8409 RLSGLKSWDRAPTFLRELSDETVVL--GQSVTLACQVSAQPAAQATWSKDGAPLESSSRVLISAT 8471

  Fly  3706 EDGRSILRFEPALHFDVGVYKVVARNKVGQTVARCRIVVATLPDAPDSPEISANSGTEILLRWKQ 3770
            .....:|.....:..|:|||.....|.:|.......:..|..|.:...|:|.......:||.||.
Human  8472 LKNFQLLTILVVVAEDLGVYTCSVSNALGTVTTTGVLRKAERPSSSPCPDIGEVYADGVLLVWKP 8536

  Fly  3771 PRDDGHSTVLCYSLQYKLSNCDAWTTVADNIDHEFYLLHDLQPNTNYQFRLASKNRIGWSEMGIP 3835
            ....|..|   |.:|..|.. .:|||:|.:|....||...|.....|.||.|..::.|......|
Human  8537 VESYGPVT---YIVQCSLEG-GSWTTLASDIFDCCYLTSKLSRGGTYTFRTACVSKAGMGPYSSP 8597

  Fly  3836 VSASTVGGDAPKIHITKAMKHLQQLTEN-GHQVVPEEERVHTDYHCEREPPNWVTDSSVSDKYSF 3899
            .....:||.:          ||....|: |....|              .|:..|       ::|
Human  8598 SEQVLLGGPS----------HLASEEESQGRSAQP--------------LPSTKT-------FAF 8631

  Fly  3900 ISEIARGEFSTIVKGIQKSTDTVVVAKILEVTDENEDNVVAEFDNFKTLRHERIPALFSAYKPLN 3964
            .::|.||.||.:.:..:|::...:.|||:....:::..|:.|::..|.|||..:..|.:||  |:
Human  8632 QTQIQRGRFSVVRQCWEKASGRALAAKIIPYHPKDKTAVLREYEALKGLRHPHLAQLHAAY--LS 8694

  Fly  3965 VPIAIFVMEKLQGADVLTYFSSRHEYSEQMVATVVTQLLDALQYLHWRGYCHLNIQPDNVVMASV 4029
            ....:.::|...|.::|...:.|..|||..|...:.|:|.|.||||.:...||:::.:|:::...
Human  8695 PRHLVLILELCSGPELLPCLAERASYSESEVKDYLWQMLSATQYLHNQHILHLDLRSENMIITEY 8759

  Fly  4030 RSIQVKLVDFGSAKKVNKLGMKVTPCGS----LDFQPPEMINDEPIFPQSDIWSLGALTYLLLSG 4090
            ..:  |:||.|:|:.:::  .||.|...    |:...||::..:...||:|||::|...:::||.
Human  8760 NLL--KVVDLGNAQSLSQ--EKVLPSDKFKDYLETMAPELLEGQGAVPQTDIWAIGVTAFIMLSA 8820

  Fly  4091 CSPFRGADEYETKQNISFVRYRFENLFKEVTPEATRFIMLLFKRHPTKRPYTEDCLEHRWLMSSD 4155
            ..|.......:.::.:.....|....:..::..|..|:.......|..||....||:..||....
Human  8821 EYPVSSEGARDLQRGLRKGLVRLSRCYAGLSGGAVAFLRSTLCAQPWGRPCASSCLQCPWLTEEG 8885

  Fly  4156 YMVRKRERAIFLGSRLKTF 4174
            ....:.....|..:||:.|
Human  8886 PACSRPAPVTFPTARLRVF 8904

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ObscNP_001097440.1 RhoGEF 90..260 CDD:238091
PH_unc89 275..388 CDD:270134
Not5 <477..>652 CDD:444384
Ig 1017..1108 CDD:472250 28/99 (28%)
Ig strand B 1034..1038 CDD:409353 2/5 (40%)
Ig strand C 1046..1050 CDD:409353 1/3 (33%)
Ig strand E 1074..1078 CDD:409353 2/10 (20%)
Ig strand F 1088..1093 CDD:409353 1/4 (25%)
Ig strand G 1101..1104 CDD:409353 0/2 (0%)
I-set 1123..1212 CDD:400151 19/88 (22%)
Ig strand B 1140..1144 CDD:409353 0/3 (0%)
Ig strand C 1153..1157 CDD:409353 0/3 (0%)
Ig strand E 1182..1186 CDD:409353 2/3 (67%)
Ig strand F 1196..1201 CDD:409353 3/4 (75%)
Ig strand G 1209..1212 CDD:409353 0/2 (0%)
Ig <1236..1299 CDD:472250 19/78 (24%)
Ig strand C 1238..1242 CDD:409353 1/14 (7%)
Ig strand E 1259..1269 CDD:409353 4/14 (29%)
Ig strand F 1279..1284 CDD:409353 3/4 (75%)
Ig strand G 1292..1295 CDD:409353 0/2 (0%)
I-set 1313..1403 CDD:400151 25/92 (27%)
Ig strand B 1330..1334 CDD:409353 2/5 (40%)
Ig strand C 1343..1347 CDD:409353 1/3 (33%)
Ig strand E 1369..1373 CDD:409353 1/3 (33%)
Ig strand F 1383..1388 CDD:409353 2/4 (50%)
Ig strand G 1396..1399 CDD:409353 1/2 (50%)
Ig_3 1406..1487 CDD:464046 14/88 (16%)
I-set 1499..1595 CDD:400151 19/95 (20%)
Ig strand B 1522..1526 CDD:409353 1/3 (33%)
Ig strand C 1535..1539 CDD:409353 0/3 (0%)
Ig strand E 1561..1565 CDD:409353 2/3 (67%)
Ig strand F 1575..1580 CDD:409353 0/4 (0%)
Ig strand G 1588..1591 CDD:409353 1/2 (50%)
Ig 1599..1690 CDD:472250 21/99 (21%)
Ig strand B 1617..1621 CDD:409353 2/3 (67%)
Ig strand C 1630..1634 CDD:409353 1/3 (33%)
Ig strand E 1656..1660 CDD:409353 1/3 (33%)
Ig strand F 1670..1675 CDD:409353 0/4 (0%)
Ig strand G 1683..1686 CDD:409353 0/2 (0%)
I-set 1694..1786 CDD:400151 25/94 (27%)
Ig strand B 1711..1715 CDD:409353 0/3 (0%)
Ig strand C 1724..1728 CDD:409353 0/3 (0%)
Ig strand E 1752..1756 CDD:409353 1/3 (33%)
Ig strand F 1766..1771 CDD:409353 0/4 (0%)
Ig strand G 1779..1782 CDD:409353 0/2 (0%)
Ig <1836..1903 CDD:472250 19/79 (24%)
Ig strand C 1846..1850 CDD:409353 2/3 (67%)
Ig strand E 1871..1875 CDD:409353 1/3 (33%)
Ig strand F 1885..1890 CDD:409353 1/4 (25%)
Ig 1922..2005 CDD:472250 23/132 (17%)
Ig strand B 1933..1937 CDD:409353 1/3 (33%)
Ig strand C 1946..1950 CDD:409353 2/21 (10%)
Ig strand E 1971..1984 CDD:409353 4/12 (33%)
Ig strand F 1994..1999 CDD:409353 2/4 (50%)
Ig 2018..2108 CDD:472250 26/138 (19%)
Ig strand B 2034..2038 CDD:409353 3/13 (23%)
Ig strand C 2047..2051 CDD:409353 0/3 (0%)
Ig strand E 2074..2078 CDD:409353 1/7 (14%)
Ig strand F 2088..2093 CDD:409353 1/36 (3%)
Ig strand G 2101..2104 CDD:409353 0/2 (0%)
Ig 2113..2214 CDD:472250 20/112 (18%)
Ig strand B 2130..2134 CDD:409353 0/3 (0%)
Ig strand C 2143..2147 CDD:409353 0/3 (0%)
Ig strand E 2176..2185 CDD:409353 1/15 (7%)
Ig strand F 2195..2200 CDD:409353 1/4 (25%)
I-set 2220..2302 CDD:400151 22/81 (27%)
Ig strand B 2238..2242 CDD:409353 2/3 (67%)
Ig strand C 2251..2255 CDD:409353 0/3 (0%)
Ig strand E 2277..2281 CDD:409353 1/3 (33%)
Ig strand F 2291..2296 CDD:409353 1/4 (25%)
Ig strand G 2304..2307 CDD:409353 0/2 (0%)
I-set 2318..2408 CDD:400151 21/135 (16%)
Ig strand B 2335..2339 CDD:409353 0/3 (0%)
Ig strand C 2348..2352 CDD:409353 2/3 (67%)
Ig strand E 2374..2378 CDD:409353 0/3 (0%)
Ig strand F 2388..2393 CDD:409353 2/28 (7%)
Ig 2415..2506 CDD:472250 34/90 (38%)
Ig strand B 2432..2436 CDD:409353 1/3 (33%)
Ig strand C 2445..2449 CDD:409353 0/3 (0%)
Ig strand E 2472..2476 CDD:409353 1/3 (33%)
Ig strand F 2486..2491 CDD:409353 1/4 (25%)
Ig strand G 2499..2502 CDD:409353 0/2 (0%)
I-set 2519..2608 CDD:400151 29/104 (28%)
Ig strand B 2536..2540 CDD:409353 1/4 (25%)
Ig strand C 2549..2553 CDD:409353 0/3 (0%)
Ig strand E 2574..2578 CDD:409353 1/4 (25%)
Ig strand F 2588..2593 CDD:409353 1/4 (25%)
I-set 2615..2696 CDD:400151 21/178 (12%)
Ig strand B 2632..2636 CDD:409353 0/3 (0%)
Ig strand C 2645..2649 CDD:409353 0/3 (0%)
Ig strand E 2670..2674 CDD:409353 2/3 (67%)
Ig strand F 2684..2689 CDD:409353 2/4 (50%)
Ig strand G 2697..2700 CDD:409353 2/2 (100%)
I-set 2717..2805 CDD:400151 25/203 (12%)
Ig strand B 2734..2738 CDD:409353 1/3 (33%)
Ig strand C 2747..2751 CDD:409353 1/3 (33%)
Ig strand E 2773..2777 CDD:409353 0/3 (0%)
Ig strand F 2787..2792 CDD:409353 1/4 (25%)
Ig strand G 2800..2803 CDD:409353 0/14 (0%)
FN3 2834..2925 CDD:238020 27/178 (15%)
Ig <2996..3063 CDD:472250 22/67 (33%)
Ig strand C 3003..3007 CDD:409353 0/3 (0%)
Ig strand E 3029..3033 CDD:409353 1/3 (33%)
Ig strand F 3043..3048 CDD:409353 2/4 (50%)
Ig strand G 3056..3059 CDD:409353 1/2 (50%)
Ig 3067..3157 CDD:472250 28/149 (19%)
Ig strand B 3085..3088 CDD:409353 0/2 (0%)
Ig strand C 3097..3101 CDD:409353 1/3 (33%)
Ig strand E 3123..3127 CDD:409353 2/3 (67%)
Ig strand F 3137..3142 CDD:409353 1/4 (25%)
Ig strand G 3150..3153 CDD:409353 0/2 (0%)
PK_Unc-89_rpt1 3182..3440 CDD:271011 81/257 (32%)
Ig 3654..3744 CDD:472250 22/114 (19%)
Ig strand B 3671..3675 CDD:409353 0/3 (0%)
Ig strand C 3684..3688 CDD:409353 0/3 (0%)
Ig strand E 3710..3714 CDD:409353 1/3 (33%)
Ig strand F 3724..3729 CDD:409353 2/4 (50%)
Ig strand G 3737..3740 CDD:409353 0/2 (0%)
FN3 3748..3840 CDD:238020 26/91 (29%)
STKc_Unc-89_rpt2 3893..4151 CDD:271014 66/261 (25%)
OBSCNNP_001373054.1 Ig strand F 5004..5009 CDD:409559 2/4 (50%)
Ig strand G 5013..5016 CDD:409559 1/2 (50%)
Ig 5026..5111 CDD:472250 13/89 (15%)
Ig strand B 5042..5046 CDD:409559 0/3 (0%)
Ig strand C 5056..5060 CDD:409559 2/3 (67%)
Ig strand E 5081..5085 CDD:409559 1/8 (13%)
Ig strand F 5095..5100 CDD:409559 1/4 (25%)
Ig strand G 5104..5107 CDD:409559 1/2 (50%)
IG_like 5126..5202 CDD:214653 17/80 (21%)
Ig strand B 5133..5137 CDD:409405 1/3 (33%)
Ig strand C 5146..5150 CDD:409405 0/3 (0%)
Ig strand E 5172..5176 CDD:409405 2/3 (67%)
Ig strand F 5186..5191 CDD:409405 0/4 (0%)
Ig 5205..5293 CDD:472250 21/99 (21%)
Ig strand B 5224..5228 CDD:409405 1/3 (33%)
Ig strand C 5237..5241 CDD:409405 1/3 (33%)
Ig strand E 5263..5267 CDD:409405 1/3 (33%)
Ig strand G 5286..5289 CDD:409405 0/2 (0%)
FN3 5480..5565 CDD:238020 13/88 (15%)
IG_like 5587..>5652 CDD:214653 13/75 (17%)
Ig strand B 5598..5602 CDD:409559 0/3 (0%)
Ig strand C 5610..5614 CDD:409559 1/3 (33%)
Ig strand E 5635..5639 CDD:409559 1/3 (33%)
I-set 5855..5945 CDD:400151 28/118 (24%)
Ig strand B 5872..5876 CDD:409565 2/3 (67%)
Ig strand C 5885..5889 CDD:409565 0/3 (0%)
Ig strand E 5911..5915 CDD:409565 1/3 (33%)
Ig strand F 5925..5930 CDD:409565 1/4 (25%)
Ig strand G 5938..5941 CDD:409565 0/2 (0%)
I-set 6083..6173 CDD:400151 34/90 (38%)
Ig strand B 6100..6104 CDD:409405 1/3 (33%)
Ig strand C 6113..6117 CDD:409405 0/3 (0%)
Ig strand E 6139..6143 CDD:409405 1/3 (33%)
Ig strand F 6153..6158 CDD:409405 1/4 (25%)
Ig strand G 6166..6169 CDD:409405 0/2 (0%)
I-set 6217..6307 CDD:400151 29/90 (32%)
Ig strand B 6234..6239 CDD:409564 1/4 (25%)
Ig strand C 6248..6252 CDD:409564 0/3 (0%)
Ig strand E 6273..6277 CDD:409564 1/3 (33%)
Ig strand F 6287..6292 CDD:409564 1/4 (25%)
Ig strand G 6300..6303 CDD:409564 1/2 (50%)
Ig 6328..6423 CDD:472250 21/94 (22%)
Ig strand B 6345..6349 CDD:409543 0/3 (0%)
Ig strand C 6358..6362 CDD:409543 0/3 (0%)
Ig strand E 6389..6393 CDD:409543 2/3 (67%)
Ig strand F 6403..6408 CDD:409543 2/4 (50%)
Ig strand G 6416..6419 CDD:409543 0/2 (0%)
SH3_Obscurin_like 6559..6621 CDD:212958 8/61 (13%)
RhoGEF 6654..6832 CDD:214619 26/179 (15%)
PH_Obscurin 6839..6963 CDD:270059 18/123 (15%)
IgI_1_Titin-A168_like 6971..7061 CDD:409563 8/91 (9%)
Ig strand A' 6976..6982 CDD:409563 1/5 (20%)
Ig strand B 6987..6995 CDD:409563 0/7 (0%)
Ig strand C 7001..7006 CDD:409563 0/4 (0%)
Ig strand C' 7009..7011 CDD:409563 0/1 (0%)
Ig strand D 7017..7024 CDD:409563 0/6 (0%)
Ig strand E 7027..7033 CDD:409563 0/5 (0%)
Ig strand F 7040..7048 CDD:409563 0/7 (0%)
Ig strand G 7051..7061 CDD:409563 0/9 (0%)
I-set 7065..7154 CDD:400151 23/88 (26%)
Ig strand B 7082..7086 CDD:409564 0/3 (0%)
Ig strand C 7095..7099 CDD:409564 0/3 (0%)
Ig strand E 7122..7126 CDD:409564 1/3 (33%)
Ig strand F 7136..7141 CDD:409564 2/4 (50%)
Ig strand G 7149..7152 CDD:409564 1/2 (50%)
I-set 7314..7403 CDD:400151 22/89 (25%)
Ig strand B 7331..7335 CDD:409565 0/3 (0%)
Ig strand C 7344..7348 CDD:409565 1/3 (33%)
Ig strand E 7370..7373 CDD:409565 1/2 (50%)
Ig strand F 7383..7388 CDD:409565 1/4 (25%)
Ig strand G 7396..7399 CDD:409565 0/2 (0%)
STKc_obscurin_rpt1 7422..7678 CDD:271009 82/267 (31%)
Atrophin-1 7758..>8033 CDD:460830 31/276 (11%)
I-set 8420..8505 CDD:400151 18/86 (21%)
Ig strand B 8437..8441 CDD:409570 0/3 (0%)
Ig strand C 8450..8454 CDD:409570 0/3 (0%)
Ig strand E 8475..8480 CDD:409570 1/4 (25%)
Ig strand F 8490..8495 CDD:409570 2/4 (50%)
Ig strand G 8503..8506 CDD:409570 0/2 (0%)
FN3 8514..8592 CDD:214495 25/81 (31%)
STKc_obscurin_rpt2 8625..8881 CDD:271012 67/268 (25%)
I-set 10..99 CDD:400151
Ig strand B 27..31 CDD:409490
Ig strand C 40..44 CDD:409490
Ig strand E 62..66 CDD:409490
Ig strand F 79..84 CDD:409490
I-set 110..201 CDD:400151
Ig strand B 127..131 CDD:409562
Ig strand C 140..144 CDD:409562
Ig strand E 167..171 CDD:409562
Ig strand F 181..186 CDD:409562
I-set 248..328 CDD:400151
Ig strand B 255..259 CDD:409405
Ig strand C 268..272 CDD:409405
Ig strand E 294..298 CDD:409405
Ig strand F 308..313 CDD:409405
Ig strand G 321..324 CDD:409405
Ig 335..418 CDD:472250
Ig strand B 350..354 CDD:409543
Ig strand C 362..366 CDD:409543
Ig strand E 387..391 CDD:409543
Ig strand F 401..405 CDD:409543
Ig 427..505 CDD:472250
Ig strand B 438..442 CDD:409559
Ig strand C 450..454 CDD:409559
Ig strand E 475..479 CDD:409559
Ig strand F 489..494 CDD:409559
Ig strand G 498..501 CDD:409559
FN3 515..602 CDD:238020
Ig 617..>673 CDD:472250
Ig 711..791 CDD:472250
Ig strand B 724..728 CDD:409559
Ig strand C 736..740 CDD:409559
Ig strand E 761..765 CDD:409559
Ig strand F 775..780 CDD:409559
Ig strand G 784..787 CDD:409559
Ig 807..883 CDD:472250
Ig strand B 815..819 CDD:409559
Ig strand C 827..831 CDD:409559
Ig strand E 853..857 CDD:409559
Ig strand F 867..872 CDD:409559
Ig strand G 876..879 CDD:409559
Ig 894..975 CDD:472250
Ig strand B 908..912 CDD:409559
Ig strand C 920..924 CDD:409559
Ig strand E 945..949 CDD:409559
Ig strand F 959..964 CDD:409559
Ig strand G 968..971 CDD:409559
Ig 986..1067 CDD:472250
Ig strand B 1000..1004 CDD:409559
Ig strand C 1012..1016 CDD:409559
Ig strand E 1037..1041 CDD:409559
Ig strand F 1051..1056 CDD:409559
Ig strand G 1060..1063 CDD:409559
Ig 1078..1159 CDD:472250
Ig strand B 1092..1096 CDD:409559
Ig strand C 1104..1108 CDD:409559
Ig strand E 1129..1133 CDD:409559
Ig strand F 1143..1148 CDD:409559
Ig strand G 1152..1155 CDD:409559
Ig 1170..1251 CDD:472250
Ig strand B 1184..1188 CDD:409559
Ig strand C 1196..1200 CDD:409559
Ig strand E 1221..1225 CDD:409559
Ig strand F 1235..1240 CDD:409559
Ig strand G 1244..1247 CDD:409559
Ig 1262..1343 CDD:472250
Ig strand B 1276..1280 CDD:409559
Ig strand C 1288..1292 CDD:409559
Ig strand E 1313..1317 CDD:409559
Ig strand F 1327..1332 CDD:409559
Ig strand G 1336..1339 CDD:409559
Ig 1359..1435 CDD:472250
Ig strand B 1368..1372 CDD:409559
Ig strand C 1380..1384 CDD:409559
Ig strand E 1405..1409 CDD:409559
Ig strand F 1419..1424 CDD:409559
Ig strand G 1428..1431 CDD:409559
Ig 1446..1527 CDD:472250
Ig strand B 1460..1464 CDD:409559
Ig strand C 1472..1476 CDD:409559
Ig strand E 1497..1501 CDD:409559
Ig strand F 1511..1516 CDD:409559
Ig strand G 1520..1523 CDD:409559
Ig 1538..1619 CDD:472250
Ig strand B 1552..1556 CDD:409559
Ig strand C 1564..1568 CDD:409559
Ig strand E 1589..1593 CDD:409559
Ig strand F 1603..1608 CDD:409559
Ig strand G 1612..1615 CDD:409559
Ig 1630..1711 CDD:472250
Ig strand B 1644..1648 CDD:409559
Ig strand C 1656..1660 CDD:409559
Ig strand E 1681..1685 CDD:409559
Ig strand F 1695..1700 CDD:409559
Ig strand G 1704..1707 CDD:409559
IgI_C2_MyBP-C-like 1722..1803 CDD:409559
Ig strand A 1722..1724 CDD:409559
Ig strand A' 1727..1731 CDD:409559
Ig strand B 1735..1741 CDD:409559
Ig strand C 1748..1753 CDD:409559
Ig strand C' 1756..1759 CDD:409559
Ig strand D 1764..1769 CDD:409559
Ig strand E 1772..1777 CDD:409559
Ig strand F 1786..1792 CDD:409559
Ig strand G 1795..1803 CDD:409559
Ig 1814..1895 CDD:472250
Ig strand B 1828..1832 CDD:409559
Ig strand C 1840..1844 CDD:409559
Ig strand E 1865..1869 CDD:409559
Ig strand F 1879..1884 CDD:409559
Ig strand G 1888..1891 CDD:409559
Ig 1913..1994 CDD:472250
Ig strand B 1927..1931 CDD:409559
Ig strand C 1939..1943 CDD:409559
Ig strand E 1964..1968 CDD:409559
Ig strand F 1978..1983 CDD:409559
Ig strand G 1987..1990 CDD:409559
Ig 2005..2086 CDD:472250
Ig strand B 2019..2023 CDD:409559
Ig strand C 2031..2035 CDD:409559
Ig strand E 2056..2060 CDD:409559
Ig strand F 2070..2075 CDD:409559
Ig strand G 2079..2082 CDD:409559
Ig 2091..2168 CDD:472250
Ig strand B 2111..2115 CDD:409353
Ig strand C 2124..2128 CDD:409353
Ig strand E 2149..2153 CDD:409353
Ig strand F 2163..2168 CDD:409353
Ig 2185..2268 CDD:472250
Ig strand B 2201..2205 CDD:409559
Ig strand C 2213..2217 CDD:409559
Ig strand E 2238..2242 CDD:409559
Ig strand F 2252..2257 CDD:409559
Ig strand G 2261..2264 CDD:409559
Ig 2275..2358 CDD:472250
Ig strand B 2291..2295 CDD:409564
Ig strand C 2304..2307 CDD:409564
Ig strand E 2328..2332 CDD:409564
Ig strand F 2342..2347 CDD:409564
Ig 2365..2444 CDD:472250
Ig strand B 2380..2384 CDD:409543
Ig strand C 2392..2396 CDD:409543
Ig strand E 2417..2421 CDD:409543
Ig strand F 2431..2436 CDD:409543
Ig 2453..2536 CDD:472250
Ig 2542..2625 CDD:472250
Ig strand B 2558..2562 CDD:409559
Ig strand C 2570..2574 CDD:409559
Ig strand E 2595..2599 CDD:409559
Ig strand F 2609..2614 CDD:409559
Ig strand G 2618..2621 CDD:409559
Ig 2631..2714 CDD:472250
Ig strand B 2647..2651 CDD:409353
Ig strand C 2660..2663 CDD:409353
Ig strand E 2684..2688 CDD:409353
Ig strand F 2698..2703 CDD:409353
Ig 2722..2803 CDD:472250
Ig strand B 2736..2740 CDD:409564
Ig strand C 2748..2752 CDD:409564
Ig strand E 2773..2777 CDD:409564
Ig strand F 2787..2792 CDD:409564
Ig strand G 2796..2799 CDD:409564
I-set 2899..2982 CDD:400151
Ig strand B 2915..2919 CDD:409353
Ig strand C 2928..2931 CDD:409353
Ig strand E 2952..2956 CDD:409353
Ig strand F 2966..2971 CDD:409353
Ig 2989..3071 CDD:472250
Ig strand B 3004..3008 CDD:409405
Ig strand C 3016..3020 CDD:409405
Ig strand E 3041..3045 CDD:409405
Ig strand F 3055..3060 CDD:409405
Ig strand G 3064..3067 CDD:409405
Ig 3077..3160 CDD:472250
Ig strand C 3105..3109 CDD:409353
Ig strand E 3130..3134 CDD:409353
Ig strand F 3144..3149 CDD:409353
Ig 3167..3251 CDD:472250
IG_like 3263..3340 CDD:214653
Ig strand B 3273..3277 CDD:409559
Ig strand C 3285..3289 CDD:409559
Ig strand E 3310..3314 CDD:409559
Ig strand F 3324..3329 CDD:409559
Ig strand G 3333..3336 CDD:409559
Ig 3347..3429 CDD:472250
Ig strand B 3362..3366 CDD:409353
Ig strand C 3374..3378 CDD:409353
Ig strand E 3399..3403 CDD:409353
IG_like 3441..3520 CDD:214653
Ig strand B 3451..3455 CDD:409405
Ig strand C 3464..3468 CDD:409405
Ig strand E 3490..3494 CDD:409405
Ig strand G 3513..3516 CDD:409405
Ig 3526..3606 CDD:472250
Ig strand B 3542..3546 CDD:409559
Ig strand C 3554..3558 CDD:409559
Ig strand E 3579..3583 CDD:409559
Ig strand F 3593..3598 CDD:409559
Ig strand G 3602..3605 CDD:409559
Ig 3615..3698 CDD:472250
Ig strand B 3631..3635 CDD:409565
Ig strand C 3644..3647 CDD:409565
Ig strand E 3669..3672 CDD:409565
Ig strand G 3691..3694 CDD:409565
Ig 3704..3786 CDD:472250
Ig strand B 3720..3724 CDD:409559
Ig strand C 3731..3735 CDD:409559
Ig strand E 3756..3760 CDD:409559
Ig strand F 3770..3775 CDD:409559
Ig strand G 3779..3782 CDD:409559
Ig 3792..3874 CDD:472250
Ig strand B 3808..3812 CDD:409559
Ig strand C 3819..3823 CDD:409559
Ig strand E 3844..3848 CDD:409559
Ig strand F 3858..3863 CDD:409559
Ig strand G 3867..3870 CDD:409559
Ig 3880..3962 CDD:472250
Ig strand B 3896..3900 CDD:409559
Ig strand C 3907..3911 CDD:409559
Ig strand E 3932..3936 CDD:409559
Ig strand F 3946..3951 CDD:409559
Ig strand G 3955..3958 CDD:409559
Ig 3968..4050 CDD:472250
Ig strand B 3984..3988 CDD:409544
Ig strand E 4017..4024 CDD:409544
Ig strand F 4034..4039 CDD:409544
Ig strand G 4043..4046 CDD:409544
Ig 4056..4138 CDD:472250
Ig strand B 4072..4076 CDD:409559
Ig strand C 4083..4087 CDD:409559
Ig strand E 4108..4112 CDD:409559
Ig strand F 4122..4127 CDD:409559
Ig strand G 4131..4134 CDD:409559
Ig 4144..4226 CDD:472250
Ig strand B 4160..4164 CDD:409559
Ig strand C 4171..4175 CDD:409559
Ig strand E 4196..4200 CDD:409559
Ig strand F 4210..4215 CDD:409559
Ig strand G 4219..4222 CDD:409559
Ig 4232..4314 CDD:472250
Ig strand B 4248..4252 CDD:409559
Ig strand C 4259..4263 CDD:409559
Ig strand E 4284..4288 CDD:409559
Ig strand F 4298..4303 CDD:409559
Ig strand G 4307..4310 CDD:409559
Ig 4320..4402 CDD:472250
Ig strand B 4336..4340 CDD:409559
Ig strand C 4347..4351 CDD:409559
Ig strand E 4372..4376 CDD:409559
Ig strand F 4386..4391 CDD:409559
Ig strand G 4395..4398 CDD:409559
Ig 4408..4490 CDD:472250
Ig strand B 4424..4428 CDD:409559
Ig strand C 4435..4439 CDD:409559
Ig strand E 4460..4464 CDD:409559
Ig strand F 4474..4479 CDD:409559
Ig strand G 4483..4486 CDD:409559
Ig 4496..4578 CDD:472250 10/50 (20%)
Ig strand B 4512..4516 CDD:409358
Ig strand C 4524..4527 CDD:409358 881/4699 (19%)
Ig strand E 4545..4552 CDD:409358 3/6 (50%)
Ig strand F 4562..4567 CDD:409358 1/4 (25%)
Ig 4584..4666 CDD:472250 15/83 (18%)
Ig strand B 4600..4604 CDD:409559 1/3 (33%)
Ig strand C 4611..4615 CDD:409559 1/3 (33%)
Ig strand E 4636..4640 CDD:409559 0/3 (0%)
Ig strand F 4650..4655 CDD:409559 0/4 (0%)
Ig strand G 4659..4662 CDD:409559 0/2 (0%)
IG_like 4679..4754 CDD:214653 28/91 (31%)
Ig strand B 4688..4692 CDD:409559 1/3 (33%)
Ig strand C 4699..4703 CDD:409559 2/5 (40%)
Ig strand E 4724..4728 CDD:409559 1/3 (33%)
Ig strand F 4738..4743 CDD:409559 1/6 (17%)
Ig strand G 4747..4750 CDD:409559 1/4 (25%)
Ig 4760..4842 CDD:472250 19/87 (22%)
Ig strand B 4776..4780 CDD:409559 0/3 (0%)
Ig strand C 4787..4791 CDD:409559 0/3 (0%)
Ig strand E 4812..4816 CDD:409559 2/6 (33%)
Ig strand F 4826..4831 CDD:409559 3/4 (75%)
Ig strand G 4835..4838 CDD:409559 0/2 (0%)
I-set 4847..4931 CDD:400151 22/97 (23%)
Ig strand B 4864..4868 CDD:409559 0/3 (0%)
Ig strand C 4876..4880 CDD:409559 0/3 (0%)
Ig strand E 4901..4905 CDD:409559 1/3 (33%)
Ig strand F 4915..4920 CDD:409559 3/8 (38%)
Ig strand G 4924..4927 CDD:409559 0/2 (0%)
Ig 4937..5007 CDD:472250 23/83 (28%)
Ig strand B 4953..4957 CDD:409559 2/3 (67%)
Ig strand C 4965..4969 CDD:409559 1/3 (33%)
Ig strand E 4990..4994 CDD:409559 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.