DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obsc and ttn

DIOPT Version :10

Sequence 1:NP_001097440.1 Gene:Obsc / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:XP_031748776.1 Gene:ttn / 733882 XenbaseID:XB-GENE-6031746 Length:33494 Species:Xenopus tropicalis


Alignment Length:4467 Identity:931/4467 - (20%)
Similarity:1572/4467 - (35%) Gaps:1164/4467 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 VRDNKDIIFCNFLQIAEFHNNVLKEGLKCYSNQ---------------------------PNMVA 162
            :|..|:|:.....:|: |.||:  ..||.||..                           ...:.
 Frog  5380 LRQGKEIVSGKKYRIS-FKNNI--ASLKFYSADIQDSGEYSFEVSNDVGSSSCKTTLTVLDRTLP 5441

  Fly   163 KTFLRLERDFDKHV-VYCQNEPLAQDYLGSSPDAKKYFQELSKQLGDDK---SLAE--------H 215
            .:|.:..||.|..: |:|:.|....   ||.|....:|:. .|:||.||   |..|        |
 Frog  5442 PSFTKALRDIDSVINVFCRLECKVS---GSLPMKVAWFKN-DKELGIDKHKISFVEGSASMEISH 5502

  Fly   216 LKLPIQRINDYQLLFKDFIKYSLSLKEN--VKDLERALELMLSVPSRAYDNRFLSSIEG---CRG 275
            |.|     ||..:       |:.....:  ||:.:..|.:. ..||.......|.::.|   |..
 Frog  5503 LNL-----NDAGI-------YTCRATNSAGVKECKGTLTVK-EPPSFTAKPDSLDAVPGSTVCLK 5554

  Fly   276 NIYKLGRLLLHAWCNVVD--KEGKAHDRYCFLFK----SRILVTKVRKISENRSVFILQNIVKLP 334
            ..:|....|...|...|:  |.|.|    |::.|    |.:.:..|:.......|..:.|.....
 Frog  5555 TTFKGTPPLSIKWYKGVEELKTGGA----CYIAKENTESSLELYAVKTSDSGNYVCKVSNTAGAV 5615

  Fly   335 LCNIELKADEKQIHLSLKAP----EANSFLPIDIKPHG-PEAHLTWF---NEIS-------SHIN 384
            .|:..:...|.........|    :....:.::.|..| |..::|||   .||.       |.:|
 Frog  5616 ECSANVFVKEPATFTEKLEPSQLFKRGDSVQLECKVSGTPRINITWFKNDREIKESDTCRMSFLN 5680

  Fly   385 QDVTLQEHNADDLKVDASQIASESELILHLPQRAEAHDPNLSVRPSDVAENYFLSKE--TKERLQ 447
            ...||  |.:.....|:.:...::        |.||        .||:.....:.||  |.:| :
 Frog  5681 SVATL--HLSSISLEDSGEYVCQA--------RNEA--------GSDICSCAVIVKEPPTFKR-E 5726

  Fly   448 HEQQELLK-----LEQEA-------IELYKKQQSSKSVSS----KT--------------ESVEI 482
            .|..::|:     ||.|.       :..:|   .||.|.|    ||              :|.:|
 Frog  5727 FENADVLRDTDVILEGEVLGSAPFEVSWFK---DSKPVRSGRKYKTFFQDTQLSLNILRFDSTDI 5788

  Fly   483 TSSQVKSSSEV-----RKVVSPPPPP-------------------QAQVKEVTPVKV-------- 515
            ...|.:..::|     ..:|:...||                   |..||...|:.:        
 Frog  5789 GEYQCRVFNDVGSCVCSSLVTLKEPPTFTRKIENLSSLIGGLVAFQCAVKGSAPITITWWKDNDE 5853

  Fly   516 VSSPPPPKEITPAKVATPPPQPQVVTSPVKE---------------------VAPPPQPRAVASP 559
            :......|.|....|||      :....||.                     :....:|..:...
 Frog  5854 IMEDENIKAIFKNNVAT------LHIGSVKSNLGGKYTCEAKNDAGIQRCSAILAVKEPATIIDK 5912

  Fly   560 AKEVTPSQSEPVKAP---SPIKEVRKEVPPSASHSKEVEAL-VATEIRESLTETRSTVVESGQSS 620
            |..|..::.:|....   |..||:      :|..||:.:.| .:.:.:.|.||..|.:       
 Frog  5913 AVSVDVTEGDPATLQCKFSGTKEI------TAKWSKDGKELKFSAKYKISFTENVSVL------- 5964

  Fly   621 EIREEIVVTEESSLEGKQVVALERE--PSPC--SIPKIQVYRP-------------------VEC 662
                :|:.|::|. .|:....::.:  .|.|  |:..:.:..|                   :||
 Frog  5965 ----KIMSTDKSD-SGEYTFDVQNDVGRSSCTASVSVLDLIIPPSFTKKLKKMDSVKGSFVNLEC 6024

  Fly   663 ENPVVTKHKPIE---LKDIVGYSESLRDGDTAPAGGSPGRQQGYSANITDHASLTIWNNRLANIA 724
               :|:...||.   |||         |.:..|:|       .|..:..|:.:....|....:.:
 Frog  6025 ---IVSGSHPITVKWLKD---------DKEILPSG-------KYKYSFHDNIAFMEINELEGSDS 6070

  Fly   725 G-------DRSGANQ---HLQQSGPP---PPPIPPNFTRMPGFFQPLPLIAYETTIEILIVKARP 776
            |       :::|.||   :|....||   ..|:|.:  .:||.......|...||          
 Frog  6071 GTYTCAATNKAGKNQCSGYLTVKEPPYFIESPLPQD--TLPGSRVQFKAIMSGTT---------- 6123

  Fly   777 PSPPPPPPPTIKRVLVHTESLEQKTQNFFEGIYDAASSDTSLRNAKQKIRSIKSTVLKSKDSTNY 841
                   |..||......|.|....::.::   |.:||...|::||     :..|.:.:...|| 
 Frog  6124 -------PMAIKWFKDSKELLSGANRSIWK---DESSSILELQSAK-----VTDTGIYTVQITN- 6172

  Fly   842 AQDTVQKAKARDFLHIFTPP--VKKRPIYEIVEEPVNIF---------------ELEG-DYTESI 888
               .|..|..|..|.:..||  |||...:.::.:..:.|               .|:| |.::..
 Frog  6173 ---DVGTATCRATLFVKEPPRFVKKPSPFLMLRKGESTFFQCQITGTPEIKVTWYLDGNDISDKH 6234

  Fly   889 ADDFREPSADFEARGQSVGGMDDYY---SGYSRASTRRYETKTRDYDRGTSYDSTVERSQ----- 945
            ...|.:..|..|.....:|....|.   |..:.:.:...:.|.::   ..::.:|.|..:     
 Frog  6235 RISFVDGIATLEITDSDIGDSGIYVCEASNEAGSESCSIDVKVKE---APTFKTTFEPVEVVNAS 6296

  Fly   946 --------YGISSRRDRSSVDKVEARSSLLATGRTESRAASRAESRAE---------SRASY--S 991
                    :|........|.:|.|.|||       :..:..:.||..|         ....|  :
 Frog  6297 DVKLTCEVFGTPPYEVTWSKNKKEIRSS-------KKYSLVQKESEFELHIYKCEFSDAGEYQCT 6354

  Fly   992 VAESRAGIRSSSRLQEDRPLRSVDKPVVVKMLKSVQVEPGETAHFEIQFKDQPGL-VTWLKDNKP 1055
            ::....|...|:.:....|      |..::.:::|....|.:|.|:......|.| |:|:|.:|.
 Frog  6355 ISNEAGGCSCSATVHLKEP------PSFLQKIENVTTVLGSSAVFQCAVAGSPPLSVSWIKGDKI 6413

  Fly  1056 LEDRLADRITQTAAPMNSYRLDIKNCSETDAGTYTIRAQSASETTTVSAQLAVGQAPGHDETKTN 1120
            :|.   |..|......|...|.|::......|.|..:|.:.|.:....|.| :.|          
 Frog  6414 VEQ---DDNTLITFENNIATLYIRSVETHHPGRYICQATNESGSEKCFASL-IAQ---------- 6464

  Fly  1121 TEPAFLVSL-KDAEMIENTLFRFMVKIIGDPKPRVKFYKDEKEILETNDRIQIIRDKDYLGFYEL 1184
             |||.::.. |...:.:.........:.|.|:.:||::||.:.::.:  |...:..:|.:.  .|
 Frog  6465 -EPAVIIERPKSVSVTDRDPVTLECTVAGTPELQVKWFKDGRPLMPS--RFYTLSFEDNIS--RL 6524

  Fly  1185 VIADVQKTDAGTYSCKATNKHGEANCEAIATTVE--------------DKNPFGALSGQILPAGE 1235
            .|..|.|.|:|.|..|..|..|.::|.:....::              ||....::..:...:|.
 Frog  6525 RIQSVSKEDSGEYMFKVENDFGSSSCTSFLDVLDQAIPPSFTKKLTKMDKVLGSSIQMECKVSGS 6589

  Fly  1236 KPVFQ-WKRNGEEFDPEERFKVLFGEDEDSLALVFQHVKPEDAGIYTCVAQTSTGNISCSAELSV 1299
            .|:.. |.::|.|.....:.:.|..|:..||.:|  ::.|.|.|.|.|......|:..||..|:|
 Frog  6590 LPISSLWYKDGNEIIHSAKHRPLCHENTISLTIV--NLDPSDNGNYKCKVTNVAGSAECSGVLTV 6652

  Fly  1300 QGAIQTLNREPEKPTLVIEHREANASIGGSAI-LELQCKGFPKPAVQW-KHDGEVIQVDDRHKFM 1362
                       ::|...||..::..:|..|.: .:::.||.|..:::| |.|.|::   ...|..
 Frog  6653 -----------KEPPSFIEKPKSQKAIPDSLVDFKVEVKGTPPFSIKWFKEDVELL---SGTKCF 6703

  Fly  1363 YEDEESMSLVIKNVDTVD---AGVYTIEAINELGQDESSINLVVKAPPK-IKKI-TDITCSAGET 1422
            ...|.|:..:  |:.|||   :|.||.:..|::|.|..|..|:|..||| |||: |......|::
 Frog  6704 LGMEGSIGFL--NLFTVDGSSSGRYTCQVTNDVGSDSCSTMLIVPEPPKFIKKLETTKVVKIGDS 6766

  Fly  1423 IKMEIEVEGFPQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKATN 1487
            |:.|.::.|.|:  :::|....|...:|:.|.|.|.|...   .|:|:..:....:|:|:.:|:|
 Frog  6767 IRCECKISGSPE--IKITWYKNDTEIKSSDKYSMSFIDFI---PVLEINNLGTEDSGDYTCEASN 6826

  Fly  1488 DLSQTSEYWSCTVKSKPVIV-KNFESEYIHGEKENVQMTVRIDAYPEA--KLTWYHDETEIKITD 1549
            |....|.......|..||.. |...:|.:.|    |.:::..:....|  ::||:.|..:|: :.
 Frog  6827 DAGSASCSIKIVAKEPPVFCRKPSPAEILKG----VDVSLECELLGTAPFEITWFKDRRQIR-SS 6886

  Fly  1550 SKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQLLIKCAPEFTHKLKNITVAEGD 1614
            .||.::|..:...:.|......|.|.|..||||:.|:.:....|.:|..|.|..|:.::::..|:
 Frog  6887 KKYKITSKQHIACVHILNVETADIGDYHCKATNDVGTDSCICTLKLKEPPRFVKKVDSVSIISGE 6951

  Fly  1615 SNVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEE------GNDFKLIMNQVATNMQGNYTC 1673
            | :||...::........|      :.||.:..|..|.      .|...|.:.:......|.|.|
 Frog  6952 S-LELQAVIEGSQPISVLW------LKEKEDVIRESENIKISHFENIATLQIRKAELTNAGKYIC 7009

  Fly  1674 KIMNDYGKLEDNCVVTVNC--------KPKVKRGLKNVEVQEGKSFTLEVEVYSEPEAKIKWFKD 1730
            :|.||.|..|  |:..|..        ||      :|::|..|...|:|..|...||....||||
 Frog  7010 QIKNDAGMRE--CIANVTVLEPATIIEKP------ENIKVTAGDVCTIECIVAGTPELSASWFKD 7066

  Fly  1731 GHEIYEDARIKISRDTQRIENYYLTLNLARTE--DAGTYEMKATNFIGETTST------------ 1781
            |.|:..:.:.|||     :.|...::.:...|  |.|.|..:..|.:|:::.|            
 Frog  7067 GKELTSNQKYKIS-----LYNKVASIKIMSVEIADTGEYTFEVKNNVGKSSCTATVDVLDRIIPP 7126

  Fly  1782 --------------------CKV-------------------------------AVLTSEALSLE 1795
                                |||                               .||....|...
 Frog  7127 FFTKKLKETTGALGTSIVMECKVTGSSPMSISWLHNGRKLSSGDKYEIDFSDNLCVLKMNNLESS 7191

  Fly  1796 QTVTKTLIA-------------TTEEPEEGA-VPEIVHVDVFQQHSYESVP---LKYEVIATGIP 1843
            .|.:.|.:|             |.:||...| .||          ..|::|   :.:..:..|.|
 Frog  7192 DTGSYTCVASNAAGKDECSANMTVQEPPSFAKTPE----------PLEALPGMNVSFTSVIKGTP 7246

  Fly  1844 KPEAIWYHDGKPITPDKHTAITVDGDHYKLEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSLSGI 1908
            ..:.:|:.....:|.....||.:......||:..||.:::|:|..||.|..|:.|....|.:...
 Frog  7247 PFKVLWFKGSSELTSGPTYAIKLKDYVAVLELYELDTINSGDYTCVVSNDAGKDSCTTRLFVKEP 7311

  Fly  1909 AEYRKPILTQGPGLKDIKVNKGDKVCEPVVFTADPAPEIVLLKDGQPVVETNNVKLKVDKKDAEN 1973
            |.:.|.|       ||..|..|..:....::|..|...:...|:|..:.::.|..|...:|    
 Frog  7312 ATFVKKI-------KDYSVETGKPIILESIYTGTPPIYVTWEKNGAEISQSENCNLTTTEK---- 7365

  Fly  1974 GLVQYTCTLNILEAEIKDSGRYELKVKNKYGELVTSGWIDVLAKPE-ISGLNDTKCLPGDTICFE 2037
                 :|.|.:|.:..:|.|.|..:::|:.|:.|:...:.||..|. ::.|.|.:...||:...:
 Frog  7366 -----SCILEVLSSTKEDDGEYTCRIENEAGQDVSQALVTVLEPPYFVTKLEDIETTVGDSTSLQ 7425

  Fly  2038 ALVQANPKPKVSWTRGNENLCNHENCEVIADVDADKYRLVFQSVSPCEDGKYTITATNSEGRAAV 2102
            ..|...|:.:|||.:|:..|.:...|:|.  ...:...|.|..|...:..:|...|.||.|.|: 
 Frog  7426 CQVGGTPEIQVSWYKGDTKLRSTPGCKVY--FSNNVATLAFSKVDKNDSAEYICKAENSVGHAS- 7487

  Fly  2103 DFNLAVLVEKPTFIVQPESQSIHDY-----RPVSTKVLVHGVPLPTIEWFK------DDKPINYE 2156
              :.|||..:...:....::.:.|.     :||.....::|.....:.|:|      ||..:...
 Frog  7488 --SKAVLTVQDRQLPPSFARKMKDIEETIGKPVKFDCRINGSEPIEVSWYKDGVLLTDDNNVQIS 7550

  Fly  2157 AINK------------------------------------------PGKDK-------------- 2165
            .:|.                                          |..||              
 Frog  7551 FVNNVASLRILEAEMAHTGQYSCTAMNSVGTATSTAKLTITEPKRPPFFDKRAMPIGAVLGESGD 7615

  Fly  2166 -------------LYAKEDTK---KGTDQIESVLDIKSFR-----ENDVGAYTCVATNEIGVTKA 2209
                         .:.||:.:   .|..:|..:.:|...|     :.|.|.|:|:|||::|....
 Frog  7616 FQCHISGTQPIKVTWTKENKEIKTGGNYKITYISNIAHLRILKVGKGDSGLYSCLATNDVGKESC 7680

  Fly  2210 PFKLAMLSLAPSFVKKLDNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPD 2274
            ..:|::.. .|.|||||:.:..|..|.....||.:.|||...|.|.|:..|:.|:|.. |.:..|
 Frog  7681 SAELSVKE-PPKFVKKLEPSRIVKLGGSSQFECKISGSPEIKVTWYKNETELHPTEKY-IMSFAD 7743

  Fly  2275 GLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKFLKPITSQTVVVGEPLKLEA 2339
            .:..|||::....|||.|...:.|..|  .|.|:.||..:| .|.|.|..|...|:.|..:..|.
 Frog  7744 SVAVLEISNFSLEDSGDYTCEVHNDAG--CASCSTAVSVKE-PPVFSKKPTPVEVLKGVDVNFEC 7805

  Fly  2340 QVTGFPAPEVKWYKDGMLLRPSPEINFINSPNGQIGLIIDAAQPLDAGVYKCLIANKGGEIEGVS 2404
            ::.|.|..||.|:||...:|.|.:.. ::|......|.:.:....|.|.|:|...|:.|....||
 Frog  7806 ELLGTPPFEVAWFKDRRQIRSSKKYK-VSSKESLARLHVLSVDSSDIGEYQCKAVNEVGSDNCVS 7869

  Fly  2405 KVEIVPKESKPVFVAELQDASSIEGFPVKMDIKVVGNPKPKLQWFHNGHEIKPDASHIAIVENPD 2469
            .::.   :..|.||.:|.|.|.:.|...::.....|:....:.|..:..:|..::.:|.| ...:
 Frog  7870 AIKF---KEPPRFVKKLSDVSCLIGEATELQATTEGSQPISITWLKDKGDIVRESENIKI-SYVN 7930

  Fly  2470 NSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKADETAT---EEAPQFVSALRDVNAD 2531
            |.::|.|..|....||.|...|.|..|.....|.|.:.    |.||   :..|..|:|       
 Frog  7931 NVAALQIASTESSSSGKYTCQAVNEVGMRECAAMLSII----EPATIIEKPEPTRVTA------- 7984

  Fly  2532 EGQELVLSAPFISNPMPEVIWSKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANP 2596
             |:...|......:|.....|.|:...|..:::..::...|...|.|..||..|||.||..:.|.
 Frog  7985 -GETCSLECTVAGSPELVTKWYKNAKELKSDKKYSISFFNKTSTLKILMAEKGDSGAYTFEVMND 8048

  Fly  2597 LGEDSSACNANVRKVYKPPVFTQKISDQQQVFGNNAKIPVTVSGVPYPDLEWYFQDKPIPKSEKY 2661
            :||.|...:.:|.....||.||:|:.|...|.|::.::...|||.|...:.||.....|..|:||
 Frog  8049 VGESSCTVSVDVLDRVIPPSFTRKLKDTNSVLGSSTRLECKVSGSPPISISWYQNGNKIVSSDKY 8113

  Fly  2662 SIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIVNEIKKHSRSEPPVFLKKIGDC 2726
            .|....:...|.||:....|.|.:.|.|||..|.|.....|.:         .|||.|::|....
 Frog  8114 EITYTDNVCALTVNDLGSSDVGTFTCKASNVAGDDECSASLTV---------QEPPSFIRKPDPQ 8169

  Fly  2727 DIYEGMVAKFTACATGYPEPEVEWFKNDQKLFPSDRFLIDIEPNGLLRLTIKNVTEYDVGRYSCR 2791
            ::..|....||:...|.|..:|.||:.:.:|.|.....|.:: |....|.:.:|.....|.|:|.
 Frog  8170 EVLPGSNVTFTSVIKGSPPFKVHWFRGNSELLPGSNCNISLK-NSFAVLELYDVDTMQSGEYTCM 8233

  Fly  2792 IFNPYGDDICHAELFYDSLDSQQKPLEDQYTDFKKYKKSGAPPPLSEGPIISRMTDRGLLLSWNP 2856
            |.|..|.|:|...|...:..:..|.|.|...:..|             ||....|..|       
 Frog  8234 IVNDAGKDVCTTHLLVKAPATFVKKLNDSNVESGK-------------PITLECTYTG------- 8278

  Fly  2857 SVPLTPRYPITYQIEMMDLPEGDWRTLRTGVRSCACDIRNLEPFRDYRFRVRVENKFGVSDPSPY 2921
                :|...:.::....||.:.:..::.|..:||..:|.:.....|..:...|||:.|....|  
 Frog  8279 ----SPTIMVNWKKNGKDLRQSERCSITTTEKSCILEIFSATQEDDGEYTCHVENEAGHDTCS-- 8337

  Fly  2922 TQTYRQKLVPDPPKTYTYLPPGTDFRPETSPYFPKDFDIERPPHDGLAQAPQFLLREQDISYGVK 2986
                         ...:.|.|         |||               .||   |...:::.|  
 Frog  8338 -------------ALLSVLEP---------PYF---------------IAP---LEPVEVTVG-- 8360

  Fly  2987 DHNTELMWFVYGYPKPKMTYYFDDMLIESGGRFDQSYTRNGQATLFINKMLDRDVGWYEAVATNE 3051
             .:|.|...:.|.|:.|:::|..|..:.|...: :.|.:|..|||..:|:...|.|.|...|.|.
 Frog  8361 -ESTSLQCQIGGTPEIKVSWYKGDTKLRSTPAY-KMYLKNNVATLVFSKVDKNDSGEYICKAENM 8423

  Fly  3052 HGEARQRVRLEIAEH---PRFLKRPDETFIMARKNGRIEAKLVGIPLP-----------EVHWFK 3102
            .|.......|.:.|.   |.|          |||...::.. :|:|:.           ||.|:|
 Frog  8424 VGSTSSNTLLNVQERKVAPSF----------ARKVKDVQEN-IGLPVTFDCRINGSEPIEVSWYK 8477

  Fly  3103 DWKPIVDSSRIKISSYDPDIYVLSIHDSIIKDGGLYSISARNIAGSISTSVTVHIEENEDQYIY- 3166
            |...:.|.:.:: :||..::..:.|..:.:...|.||.:|.|..|:.|:|..:.:.|.:...:: 
 Frog  8478 DGVLLRDDNNVQ-TSYIDNVATIQILSTNVGHAGQYSCTASNPIGTASSSGKLILTEPKSPPLFD 8541

  Fly  3167 ------------------KTYGRHPY-----VRSKQLRYQDKYDIGD----------ELGRGTQG 3198
                              ...|..|:     ..::::|....|.|..          ::.:...|
 Frog  8542 IKPENINTPIGEAANFDCHVTGTQPFKVTWAKDNREIRSGGNYKISFTENRAHLKILKVSKVDSG 8606

  Fly  3199 I-TYHAVERSSGDNYAAKIMYGRPELRPFMLNELEMMNTFNHKNLIRPYDAYDTDRSVTLIMELA 3262
            : |.:|...:..|:.:|.:....|   |..:.:||........         |:||....|    
 Frog  8607 VYTCYASNDAGKDSCSASLGVQEP---PRFVKKLESSKIVKQG---------DSDRFDCKI---- 8655

  Fly  3263 AGGELVRDNLLRRDYYTERDIAHYIRQTLWGLEHMHEMGVGHMGLTIKDLLISVVGGDIIKVSDF 3327
            :|...:|                    .||   ..::..:.|.|......:.||.   :::::|.
 Frog  8656 SGSPEIR--------------------VLW---FKNDAEIQHGGKYAMSFVDSVA---VLEITDA 8694

  Fly  3328 GLSRK----INRHNLSTLDYGM------------PEFVS-PE-VVNKEGVNFSHDMWTVGLITYV 3374
            .:...    ...||    |.|.            |.|:: || |:..:||:         :....
 Frog  8695 TIEESGDYTCEAHN----DAGSVSCSTSLKVKEPPVFIAKPEPVLTLKGVD---------VTLQC 8746

  Fly  3375 LLGGHNPFLGIDDRETLTKIREGRWDFKDEIWTHISDDGRDFISRLLLYSPEERMDVKTALKHPW 3439
            .|.|..||             |..| |||                        |.::|::.|   
 Frog  8747 ELKGTPPF-------------EVSW-FKD------------------------RREIKSSKK--- 8770

  Fly  3440 FFMLDRPVYDHDYQIGTDRLRNYYDHFRDWYANASCKNYFRRRRLSG-------CFQHPSKMVYP 3497
                        ::|.||   ||.........:|.....::.:.::.       |   ..|:..|
 Frog  8771 ------------FKIITD---NYLASIHILKIDAGDIGEYQCKAVNEVGSDTCLC---TIKLKEP 8817

  Fly  3498 PGHVYTPENTPEPLPEPRIRAKREEVVSKYLHPDYELGLIQSESHYQYGPDTYLLQLRDVNFPVR 3562
            |..|..|:|....:.||   |:.:.:|                               :...|: 
 Frog  8818 PRFVKKPDNASSVVGEP---AELQAIV-------------------------------EGTQPI- 8847

  Fly  3563 LREYMKVAHRRSPSFALNDSVDW---SLPVIRERRRFTDIMDEEIDDERTRSRISMYAANESYSI 3624
                               |:.|   ...|:||..   :|....:|:..|...:|....|.....
 Frog  8848 -------------------SITWLKDKEEVVRESE---NISLSFVDNIATLQFLSTKPENTGKYT 8890

  Fly  3625 RRLRTELGPRLDEYTEADAMIETQREGYPPFFREKPQTIAITENQPSHIHCFAVGDPKPCVQWFK 3689
            .:::.:.|.:  |...:.|::|      |....|||....:|......:.|...|.|:....|.|
 Frog  8891 CQVKNDAGSQ--ECFASLAVLE------PAVIVEKPLPTKVTAGDSCTLECTVGGTPELTCTWIK 8947

  Fly  3690 NDMVLTESKRIKISVDEDGR-SILRFEPALHFDVGVYKVVARNKVGQTVARCRIVVAT------- 3746
            :...||...:.|||.  .|: |.|:.......|.|.|....:|.||::.....|.|:.       
 Frog  8948 DGTELTNDDKYKISF--FGKVSSLKILSTGTEDSGQYVFEVKNNVGKSSCTATIEVSDRIIPPSF 9010

  Fly  3747 ---------LPDAPDSPEISANSGTEILLRWKQPRDDGHSTVLCYSLQYKLSNCDAWTTVAD--N 3800
                     |..:..|.|...:....||:.|.   .:|:..|.....|..|::.....||:|  .
 Frog  9011 TRKLKETYGLLGSTTSMECKVSGSPPILVSWS---FNGNEIVSGGKYQSTLTDNTCTLTVSDLAT 9072

  Fly  3801 IDHEFYLLH-----------------------------DLQPNTNYQFRLASKN----RIGWSEM 3832
            :|...|..|                             ::.|.....|....:.    :|.|.:.
 Frog  9073 VDAGKYSCHANNIAGSDECSAVLSVKEPPSFLEKPEAAEVLPGATVTFAAVIRGTPPFKIAWYKE 9137

  Fly  3833 GIPVSASTVGGDAPKIHITKAMKHLQQLTENGHQVVPEEERVHTDYHC----EREPPNWVTDSSV 3893
            |..:   |.|.|. .|.:|.::..|:....:..|        ..:|.|    :....:..|...|
 Frog  9138 GTEL---TQGKDC-NITLTDSLAVLEMYNVSTSQ--------SGNYSCHISNDAGKDSCTTQLFV 9190

  Fly  3894 SDKYSFISEIARGEFST--------------------------IVKGIQKSTDTVVVAKILEVTD 3932
            .:..:|:.::...:...                          |.:..:.|..|...:.|||.:.
 Frog  9191 QEPAAFVKKLNNYQIDAGKPIVLECTYTGTLPISVTWQKNGVEITQSERCSITTTEKSCILEFSS 9255

  Fly  3933 ENEDN---VVAEFDNFKTLRHERIPALFSAYKPLNVPIAIFVMEKLQ 3976
            .:.|:   ......|  .:.|:...|..|..:|   |..|..:|.::
 Frog  9256 SSNDDDGEYTCSVKN--AIGHDTCQATISVLEP---PYFIAPLEPVE 9297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ObscNP_001097440.1 RhoGEF 90..260 CDD:238091 39/175 (22%)
PH_unc89 275..388 CDD:270134 26/133 (20%)
Not5 <477..>652 CDD:444384 41/249 (16%)
Ig 1017..1108 CDD:472250 23/91 (25%)
Ig strand B 1034..1038 CDD:409353 2/3 (67%)
Ig strand C 1046..1050 CDD:409353 2/4 (50%)
Ig strand E 1074..1078 CDD:409353 1/3 (33%)
Ig strand F 1088..1093 CDD:409353 1/4 (25%)
Ig strand G 1101..1104 CDD:409353 0/2 (0%)
I-set 1123..1212 CDD:400151 22/89 (25%)
Ig strand B 1140..1144 CDD:409353 0/3 (0%)
Ig strand C 1153..1157 CDD:409353 2/3 (67%)
Ig strand E 1182..1186 CDD:409353 1/3 (33%)
Ig strand F 1196..1201 CDD:409353 1/4 (25%)
Ig strand G 1209..1212 CDD:409353 1/2 (50%)
Ig <1236..1299 CDD:472250 18/63 (29%)
Ig strand C 1238..1242 CDD:409353 0/4 (0%)
Ig strand E 1259..1269 CDD:409353 3/9 (33%)
Ig strand F 1279..1284 CDD:409353 2/4 (50%)
Ig strand G 1292..1295 CDD:409353 1/2 (50%)
I-set 1313..1403 CDD:400151 27/94 (29%)
Ig strand B 1330..1334 CDD:409353 0/4 (0%)
Ig strand C 1343..1347 CDD:409353 1/4 (25%)
Ig strand E 1369..1373 CDD:409353 0/3 (0%)
Ig strand F 1383..1388 CDD:409353 2/4 (50%)
Ig strand G 1396..1399 CDD:409353 0/2 (0%)
Ig_3 1406..1487 CDD:464046 24/82 (29%)
I-set 1499..1595 CDD:400151 25/98 (26%)
Ig strand B 1522..1526 CDD:409353 1/3 (33%)
Ig strand C 1535..1539 CDD:409353 1/3 (33%)
Ig strand E 1561..1565 CDD:409353 0/3 (0%)
Ig strand F 1575..1580 CDD:409353 1/4 (25%)
Ig strand G 1588..1591 CDD:409353 0/2 (0%)
Ig 1599..1690 CDD:472250 23/96 (24%)
Ig strand B 1617..1621 CDD:409353 2/3 (67%)
Ig strand C 1630..1634 CDD:409353 0/3 (0%)
Ig strand E 1656..1660 CDD:409353 1/3 (33%)
Ig strand F 1670..1675 CDD:409353 2/4 (50%)
Ig strand G 1683..1686 CDD:409353 1/2 (50%)
I-set 1694..1786 CDD:400151 29/156 (19%)
Ig strand B 1711..1715 CDD:409353 1/3 (33%)
Ig strand C 1724..1728 CDD:409353 0/3 (0%)
Ig strand E 1752..1756 CDD:409353 0/3 (0%)
Ig strand F 1766..1771 CDD:409353 1/4 (25%)
Ig strand G 1779..1782 CDD:409353 1/34 (3%)
Ig <1836..1903 CDD:472250 17/66 (26%)
Ig strand C 1846..1850 CDD:409353 0/3 (0%)
Ig strand E 1871..1875 CDD:409353 1/3 (33%)
Ig strand F 1885..1890 CDD:409353 1/4 (25%)
Ig 1922..2005 CDD:472250 18/82 (22%)
Ig strand B 1933..1937 CDD:409353 0/3 (0%)
Ig strand C 1946..1950 CDD:409353 0/3 (0%)
Ig strand E 1971..1984 CDD:409353 2/12 (17%)
Ig strand F 1994..1999 CDD:409353 1/4 (25%)
Ig 2018..2108 CDD:472250 23/90 (26%)
Ig strand B 2034..2038 CDD:409353 0/3 (0%)
Ig strand C 2047..2051 CDD:409353 2/3 (67%)
Ig strand E 2074..2078 CDD:409353 1/3 (33%)
Ig strand F 2088..2093 CDD:409353 1/4 (25%)
Ig strand G 2101..2104 CDD:409353 0/2 (0%)
Ig 2113..2214 CDD:472250 26/188 (14%)
Ig strand B 2130..2134 CDD:409353 1/3 (33%)
Ig strand C 2143..2147 CDD:409353 0/3 (0%)
Ig strand E 2176..2185 CDD:409353 1/8 (13%)
Ig strand F 2195..2200 CDD:409353 2/4 (50%)
I-set 2220..2302 CDD:400151 29/81 (36%)
Ig strand B 2238..2242 CDD:409353 0/3 (0%)
Ig strand C 2251..2255 CDD:409353 1/3 (33%)
Ig strand E 2277..2281 CDD:409353 1/3 (33%)
Ig strand F 2291..2296 CDD:409353 1/4 (25%)
Ig strand G 2304..2307 CDD:409353 1/2 (50%)
I-set 2318..2408 CDD:400151 26/89 (29%)
Ig strand B 2335..2339 CDD:409353 0/3 (0%)
Ig strand C 2348..2352 CDD:409353 2/3 (67%)
Ig strand E 2374..2378 CDD:409353 1/3 (33%)
Ig strand F 2388..2393 CDD:409353 2/4 (50%)
Ig 2415..2506 CDD:472250 24/90 (27%)
Ig strand B 2432..2436 CDD:409353 0/3 (0%)
Ig strand C 2445..2449 CDD:409353 0/3 (0%)
Ig strand E 2472..2476 CDD:409353 1/3 (33%)
Ig strand F 2486..2491 CDD:409353 1/4 (25%)
Ig strand G 2499..2502 CDD:409353 0/2 (0%)
I-set 2519..2608 CDD:400151 23/88 (26%)
Ig strand B 2536..2540 CDD:409353 1/3 (33%)
Ig strand C 2549..2553 CDD:409353 0/3 (0%)
Ig strand E 2574..2578 CDD:409353 1/3 (33%)
Ig strand F 2588..2593 CDD:409353 2/4 (50%)
I-set 2615..2696 CDD:400151 28/80 (35%)
Ig strand B 2632..2636 CDD:409353 0/3 (0%)
Ig strand C 2645..2649 CDD:409353 0/3 (0%)
Ig strand E 2670..2674 CDD:409353 1/3 (33%)
Ig strand F 2684..2689 CDD:409353 1/4 (25%)
Ig strand G 2697..2700 CDD:409353 0/2 (0%)
I-set 2717..2805 CDD:400151 25/87 (29%)
Ig strand B 2734..2738 CDD:409353 1/3 (33%)
Ig strand C 2747..2751 CDD:409353 1/3 (33%)
Ig strand E 2773..2777 CDD:409353 1/3 (33%)
Ig strand F 2787..2792 CDD:409353 2/4 (50%)
Ig strand G 2800..2803 CDD:409353 1/2 (50%)
FN3 2834..2925 CDD:238020 17/90 (19%)
Ig <2996..3063 CDD:472250 19/66 (29%)
Ig strand C 3003..3007 CDD:409353 1/3 (33%)
Ig strand E 3029..3033 CDD:409353 3/3 (100%)
Ig strand F 3043..3048 CDD:409353 1/4 (25%)
Ig strand G 3056..3059 CDD:409353 0/2 (0%)
Ig 3067..3157 CDD:472250 24/100 (24%)
Ig strand B 3085..3088 CDD:409353 0/2 (0%)
Ig strand C 3097..3101 CDD:409353 2/3 (67%)
Ig strand E 3123..3127 CDD:409353 0/3 (0%)
Ig strand F 3137..3142 CDD:409353 2/4 (50%)
Ig strand G 3150..3153 CDD:409353 1/2 (50%)
PK_Unc-89_rpt1 3182..3440 CDD:271011 47/286 (16%)
Ig 3654..3744 CDD:472250 24/90 (27%)
Ig strand B 3671..3675 CDD:409353 0/3 (0%)
Ig strand C 3684..3688 CDD:409353 0/3 (0%)
Ig strand E 3710..3714 CDD:409353 2/3 (67%)
Ig strand F 3724..3729 CDD:409353 1/4 (25%)
Ig strand G 3737..3740 CDD:409353 0/2 (0%)
FN3 3748..3840 CDD:238020 20/126 (16%)
STKc_Unc-89_rpt2 3893..4151 CDD:271014 17/113 (15%)
ttnXP_031748776.1 Ig strand C 9413..9417 CDD:409353
Ig strand E 9438..9442 CDD:409353
Ig strand F 9452..9457 CDD:409353
I-set 9479..9568 CDD:400151
Ig strand B 9496..9500 CDD:409353
Ig strand C 9509..9513 CDD:409353
Ig strand E 9534..9538 CDD:409353
Ig strand F 9548..9553 CDD:409353
Ig strand G 9561..9564 CDD:409353
Ig 9575..9665 CDD:472250
Ig strand B 9593..9597 CDD:409353
Ig strand C 9606..9610 CDD:409353
Ig strand E 9631..9635 CDD:409353
Ig strand F 9645..9650 CDD:409353
Ig strand G 9658..9661 CDD:409353
I-set 9672..9761 CDD:400151
Ig strand B 9689..9693 CDD:409353
Ig strand C 9702..9706 CDD:409353
Ig strand E 9727..9731 CDD:409353
Ig strand F 9741..9746 CDD:409353
Ig strand G 9754..9757 CDD:409353
I-set 9781..9869 CDD:400151
Ig strand B 9796..9800 CDD:409353
Ig strand C 9809..9813 CDD:409353
Ig strand E 9835..9839 CDD:409353
Ig strand F 9849..9854 CDD:409353
Ig strand G 9862..9865 CDD:409353
THB 9902..9932 CDD:465725
Ig 9986..10054 CDD:472250
Ig strand B 9997..10001 CDD:409353
Ig strand C 10011..10015 CDD:409353
Ig strand E 10036..10040 CDD:409353
Ig strand F 10050..10055 CDD:409353
Ig strand G 10059..10062 CDD:409353
Ig 10069..10153 CDD:472250
Ig strand B 10086..10090 CDD:409353
Ig strand C 10098..10102 CDD:409353
Ig strand E 10123..10127 CDD:409353
Ig strand F 10137..10141 CDD:409353
I-set 10159..10245 CDD:400151
Ig strand B 10175..10179 CDD:409353
Ig strand C 10187..10191 CDD:409353
Ig strand E 10212..10216 CDD:409353
Ig strand F 10226..10231 CDD:409353
Ig strand G 10240..10243 CDD:409353
PTZ00121 <10269..10948 CDD:173412
PspC_subgroup_2 <11039..11370 CDD:468202
Ig 11382..11473 CDD:472250
Ig strand B 11402..11406 CDD:409353
Ig strand C 11415..11418 CDD:409353
Ig strand E 11439..11443 CDD:409353
Ig strand F 11453..11458 CDD:409353
IG_like 11486..11566 CDD:214653
Ig strand B 11496..11500 CDD:409353
Ig strand C 11507..11511 CDD:409353
Ig strand E 11533..11537 CDD:409353
Ig strand F 11547..11552 CDD:409353
Ig 11574..11657 CDD:472250
Ig 11665..11746 CDD:472250
Ig 11753..11835 CDD:472250
Ig strand B 11768..11772 CDD:409353
Ig strand C 11780..11783 CDD:409353
Ig strand E 11804..11808 CDD:409353
Ig strand F 11818..11823 CDD:409353
Ig 11840..11923 CDD:472250
Ig strand B 11856..11860 CDD:409353
Ig strand C 11869..11872 CDD:409353
Ig strand E 11893..11897 CDD:409353
Ig strand F 11907..11912 CDD:409353
Ig 11928..12011 CDD:472250
Ig strand B 11945..11949 CDD:409353
Ig strand C 11956..11960 CDD:409353
Ig strand E 11981..11985 CDD:409353
Ig strand F 11995..12000 CDD:409353
Ig 12017..12100 CDD:472250
Ig strand B 12033..12037 CDD:409353
Ig strand C 12045..12049 CDD:409353
Ig strand E 12070..12074 CDD:409353
Ig strand F 12084..12089 CDD:409353
Ig strand G 12093..12096 CDD:409353
Ig 12107..12181 CDD:472250
Ig strand B 12122..12126 CDD:409353
Ig strand C 12133..12138 CDD:409353
Ig strand E 12159..12163 CDD:409353
Ig strand F 12173..12178 CDD:409353
Ig 12195..12278 CDD:472250
Ig 12302..12360 CDD:472250
Ig strand C 12312..12316 CDD:409353
Ig strand E 12337..12341 CDD:409353
Ig strand F 12351..12356 CDD:409353
Ig 12373..12456 CDD:472250
Ig 12464..12545 CDD:472250
Ig strand B 12478..12482 CDD:409353
Ig strand C 12491..12494 CDD:409353
Ig strand E 12515..12519 CDD:409353
Ig strand F 12529..12534 CDD:409353
Ig 12551..12635 CDD:472250
Ig strand B 12567..12571 CDD:409353
Ig strand C 12579..12583 CDD:409353
Ig strand E 12604..12608 CDD:409353
Ig strand F 12618..12623 CDD:409353
Ig strand G 12627..12630 CDD:409353
Ig 12640..12710 CDD:472250
Ig strand B 12656..12660 CDD:409353
Ig strand C 12668..12672 CDD:409353
Ig strand E 12693..12697 CDD:409353
Ig strand F 12707..12712 CDD:409353
Ig strand G 12716..12719 CDD:409353
Ig 12735..12805 CDD:472250
Ig strand B 12745..12749 CDD:409353
Ig strand C 12757..12761 CDD:409353
Ig strand E 12782..12786 CDD:409353
Ig strand F 12796..12801 CDD:409353
Ig 12818..12902 CDD:472250
Ig strand B 12834..12838 CDD:143224
Ig strand C 12846..12850 CDD:143224
Ig strand E 12871..12875 CDD:143224
Ig strand F 12886..12891 CDD:143224
Ig strand G 12897..12900 CDD:143224
Ig 12907..12995 CDD:472250
Ig strand B 12923..12927 CDD:409353
Ig strand C 12935..12939 CDD:409353
Ig strand E 12960..12964 CDD:409353
Ig strand F 12974..12979 CDD:409353
Ig strand G 12988..12991 CDD:409353
Ig 13001..13084 CDD:472250
Ig strand B 13017..13021 CDD:409353
Ig strand C 13029..13033 CDD:409353
Ig strand E 13054..13058 CDD:409353
Ig strand F 13068..13073 CDD:409353
Ig strand G 13077..13080 CDD:409353
Ig 13091..13173 CDD:472250
Ig strand B 13106..13110 CDD:409353
Ig strand C 13118..13122 CDD:409353
Ig strand E 13143..13147 CDD:409353
Ig strand F 13157..13162 CDD:409353
Ig strand G 13166..13169 CDD:409353
Ig 13179..13261 CDD:472250
Ig 13275..13352 CDD:472250
Ig strand B 13283..13287 CDD:409353
Ig strand C 13296..13300 CDD:409353
Ig strand E 13318..13322 CDD:409353
Ig strand F 13332..13337 CDD:409353
Ig strand G 13345..13348 CDD:409353
FN3 13356..13444 CDD:238020
FN3 <13416..13789 CDD:442628
FN3 13626..14084 CDD:442628
Ig 6..98 CDD:472250
Ig strand B 23..27 CDD:409353
Ig strand C 36..40 CDD:409353
Ig strand E 63..67 CDD:409353
Ig strand F 77..82 CDD:409353
Ig strand G 90..93 CDD:409353
Ig 103..193 CDD:472250
Ig strand B 121..125 CDD:409353
Ig strand C 134..138 CDD:409353
Ig strand E 159..163 CDD:409353
Ig strand F 173..178 CDD:409353
Ig strand G 186..189 CDD:409353
PRK12323 <240..>339 CDD:481241
Ig 734..824 CDD:472250
Ig strand B 752..756 CDD:409353
Ig strand C 765..769 CDD:409353
Ig strand E 790..794 CDD:409353
Ig strand F 804..809 CDD:409353
Ig strand G 817..820 CDD:409353
I-set 869..958 CDD:400151
Ig strand B 886..890 CDD:409353
Ig strand C 899..903 CDD:409353
Ig strand E 926..930 CDD:409353
Ig strand F 940..945 CDD:409353
Ig 1071..1159 CDD:472250
Ig strand B 1086..1090 CDD:409353
Ig strand C 1099..1103 CDD:409353
Ig strand E 1125..1129 CDD:409353
Ig strand F 1139..1144 CDD:409353
Ig strand G 1152..1155 CDD:409353
Ig 1218..1308 CDD:472250
Ig strand B 1235..1239 CDD:409353
Ig strand C 1248..1252 CDD:409353
Ig strand E 1274..1278 CDD:409353
Ig strand F 1288..1293 CDD:409353
Ig strand G 1301..1304 CDD:409353
Ig 1317..1409 CDD:472250
Ig strand B 1334..1338 CDD:409353
Ig strand C 1347..1351 CDD:409353
Ig strand E 1374..1378 CDD:409353
Ig strand F 1388..1393 CDD:409353
Ig strand G 1401..1404 CDD:409353
Ig strand B 1481..1485 CDD:409353
Ig <1483..1555 CDD:472250
Ig strand C 1496..1500 CDD:409353
Ig strand E 1521..1525 CDD:409353
Ig strand F 1535..1540 CDD:409353
Ig strand G 1548..1551 CDD:409353
I-set 1602..1690 CDD:400151
Ig strand B 1619..1623 CDD:409353
Ig strand C 1632..1636 CDD:409353
Ig strand E 1656..1660 CDD:409353
Ig strand F 1670..1675 CDD:409353
Ig 1838..1929 CDD:472250
Ig strand B 1855..1859 CDD:409353
Ig strand C 1868..1872 CDD:409353
Ig strand E 1894..1898 CDD:409353
Ig strand F 1908..1913 CDD:409353
Ig strand G 1921..1924 CDD:409353
Ig 1936..2022 CDD:472250
Ig strand B 1952..1956 CDD:409353
Ig strand C 1964..1968 CDD:409353
Ig strand E 1989..1993 CDD:409353
Ig strand F 2003..2008 CDD:409353
Ig strand G 2015..2018 CDD:409353
Ig 2028..2106 CDD:472250
Ig strand B 2045..2048 CDD:409353
Ig strand C 2056..2060 CDD:409353
Ig strand E 2081..2085 CDD:409353
Ig strand F 2095..2100 CDD:409353
Ig strand G 2104..2107 CDD:409353
Ig 2117..2188 CDD:472250
Ig strand B 2133..2137 CDD:409353
Ig strand C 2146..2149 CDD:409353
Ig strand E 2170..2174 CDD:409353
Ig strand F 2184..2189 CDD:409353
Ig strand G 2195..2198 CDD:409353
Ig 2207..2290 CDD:472250
Ig 2294..2377 CDD:472250
Ig strand B 2310..2314 CDD:409353
Ig strand C 2322..2326 CDD:409353
Ig strand E 2347..2351 CDD:409353
Ig strand F 2361..2366 CDD:409353
Ig strand G 2370..2373 CDD:409353
Ig 2382..2464 CDD:472250
Ig strand C 2409..2413 CDD:409353
Ig strand E 2434..2438 CDD:409353
Ig strand F 2448..2453 CDD:409353
Ig strand G 2457..2460 CDD:409353
Ig 2468..2552 CDD:472250
Ig strand B 2484..2488 CDD:409353
Ig strand C 2494..2501 CDD:409353
Ig strand E 2522..2526 CDD:409353
Ig strand F 2536..2541 CDD:409353
Ig strand G 2545..2548 CDD:409353
Ig 2556..2639 CDD:472250
Ig strand B 2572..2576 CDD:409353
Ig strand C 2585..2588 CDD:409353
Ig strand E 2609..2613 CDD:409353
Ig strand F 2623..2628 CDD:409353
Ig 2644..2726 CDD:472250
Ig strand B 2659..2663 CDD:409353
Ig strand C 2672..2675 CDD:409353
Ig strand E 2696..2700 CDD:409353
Ig strand F 2710..2715 CDD:409353
Ig strand G 2719..2722 CDD:409353
Ig 2731..2811 CDD:472250
Ig strand B 2746..2750 CDD:409353
Ig strand C 2758..2762 CDD:409353
Ig strand E 2783..2787 CDD:409353
Ig strand F 2797..2802 CDD:409353
Ig strand G 2806..2809 CDD:409353
I-set 2819..2902 CDD:400151
Ig strand B 2835..2839 CDD:409353
Ig strand C 2847..2851 CDD:409353
Ig strand E 2872..2876 CDD:409353
Ig strand F 2886..2891 CDD:409353
Ig strand G 2895..2898 CDD:409353
Ig 2999..3089 CDD:472250
Ig strand B 3016..3020 CDD:409353
Ig strand C 3029..3033 CDD:409353
Ig strand E 3054..3058 CDD:409353
Ig strand F 3068..3073 CDD:409353
Ig strand G 3081..3084 CDD:409353
I-set 3105..3192 CDD:400151
Ig strand B 3122..3126 CDD:409353
Ig strand C 3134..3138 CDD:409353
Ig strand E 3159..3163 CDD:409353
Ig strand F 3173..3178 CDD:409353
Ig strand G 3186..3189 CDD:409353
I-set 3288..3376 CDD:400151
Ig strand B 3305..3309 CDD:409353
Ig strand C 3317..3321 CDD:409353
Ig strand E 3342..3346 CDD:409353
Ig strand F 3356..3361 CDD:409353
Ig strand G 3370..3373 CDD:409353
Ig 3460..3550 CDD:472250
Ig strand B 3478..3482 CDD:409353
Ig strand C 3491..3494 CDD:409353
Ig strand E 3516..3520 CDD:409353
Ig strand F 3530..3535 CDD:409353
Ig strand G 3543..3546 CDD:409353
I-set 3620..3709 CDD:400151
Ig strand B 3637..3641 CDD:409353
Ig strand C 3650..3654 CDD:409353
Ig strand E 3675..3679 CDD:409353
Ig strand F 3689..3694 CDD:409353
Ig strand G 3702..3705 CDD:409353
I-set 3740..3830 CDD:400151
Ig strand B 3757..3761 CDD:409353
Ig strand C 3770..3774 CDD:409353
Ig strand E 3796..3800 CDD:409353
Ig strand F 3810..3815 CDD:409353
Ig strand G 3823..3826 CDD:409353
Ig 4692..4780 CDD:472250
Ig strand C 4721..4724 CDD:409353
Ig strand E 4745..4749 CDD:409353
Ig strand F 4760..4765 CDD:409353
I-set 4785..4874 CDD:400151
Ig strand B 4802..4806 CDD:409353
Ig strand C 4815..4819 CDD:409353
Ig strand E 4840..4844 CDD:409353
Ig strand F 4854..4859 CDD:409353
Ig strand G 4867..4870 CDD:409353
I-set 4880..4969 CDD:400151
Ig strand B 4897..4901 CDD:409353
Ig strand C 4910..4914 CDD:409353
Ig strand E 4935..4939 CDD:409353
Ig strand F 4949..4954 CDD:409353
Ig strand G 4962..4965 CDD:409353
I-set 4973..5052 CDD:400151
Ig strand B 4990..4994 CDD:409353
Ig strand C 5003..5007 CDD:409353
Ig strand E 5028..5032 CDD:409353
Ig strand F 5042..5047 CDD:409353
I-set 5066..5156 CDD:400151
Ig strand B 5084..5088 CDD:409353
Ig strand C 5097..5101 CDD:409353
Ig strand E 5122..5126 CDD:409353
Ig strand F 5136..5141 CDD:409353
I-set 5160..5245 CDD:400151
Ig strand B 5177..5181 CDD:409353
Ig strand C 5190..5194 CDD:409353
Ig strand E 5215..5219 CDD:409353
Ig strand F 5229..5234 CDD:409353
Ig strand G 5242..5245 CDD:409353
I-set 5253..5342 CDD:400151
Ig strand B 5270..5274 CDD:409353
Ig strand C 5283..5287 CDD:409353
Ig strand E 5308..5312 CDD:409353
Ig strand F 5322..5327 CDD:409353
Ig strand G 5335..5338 CDD:409353
I-set 5347..5435 CDD:400151 11/57 (19%)
Ig strand B 5363..5367 CDD:409353
Ig strand C 5376..5380 CDD:409353 931/4467 (21%)
Ig strand E 5401..5405 CDD:409353 1/3 (33%)
Ig strand F 5415..5420 CDD:409353 0/4 (0%)
Ig strand G 5429..5432 CDD:409353 0/2 (0%)
I-set 5442..5530 CDD:400151 27/103 (26%)
Ig strand B 5459..5463 CDD:409353 1/3 (33%)
Ig strand C 5472..5476 CDD:409353 0/3 (0%)
Ig strand E 5496..5500 CDD:409353 0/3 (0%)
Ig strand F 5510..5515 CDD:409353 1/11 (9%)
Ig strand G 5523..5526 CDD:409353 0/2 (0%)
I-set 5534..5623 CDD:400151 19/92 (21%)
Ig strand B 5551..5555 CDD:409353 1/3 (33%)
Ig strand C 5564..5568 CDD:409353 0/3 (0%)
Ig strand E 5589..5593 CDD:409353 1/3 (33%)
Ig strand F 5603..5608 CDD:409353 1/4 (25%)
Ig strand G 5616..5619 CDD:409353 1/2 (50%)
I-set 5642..5717 CDD:400151 19/92 (21%)
Ig strand B 5645..5649 CDD:409353 0/3 (0%)
Ig strand C 5658..5662 CDD:409353 1/3 (33%)
Ig strand E 5683..5687 CDD:409353 2/5 (40%)
Ig strand F 5697..5702 CDD:409353 0/4 (0%)
Ig 5721..5809 CDD:472250 18/91 (20%)
Ig strand B 5738..5742 CDD:409353 1/3 (33%)
Ig strand C 5751..5755 CDD:409353 0/3 (0%)
Ig strand E 5776..5780 CDD:409353 0/3 (0%)
Ig strand F 5790..5795 CDD:409353 1/4 (25%)
Ig strand G 5804..5807 CDD:409353 0/2 (0%)
I-set 5814..5903 CDD:400151 12/94 (13%)
Ig strand B 5831..5835 CDD:409353 0/3 (0%)
Ig strand C 5844..5848 CDD:409353 0/3 (0%)
Ig strand E 5869..5873 CDD:409353 2/9 (22%)
Ig strand F 5883..5888 CDD:409353 0/4 (0%)
Ig strand G 5897..5900 CDD:409353 0/2 (0%)
I-set 5915..5996 CDD:400151 20/98 (20%)
Ig strand B 5924..5928 CDD:409353 0/3 (0%)
Ig strand C 5937..5941 CDD:409353 1/3 (33%)
Ig strand E 5962..5966 CDD:409353 1/14 (7%)
Ig strand F 5976..5981 CDD:409353 0/4 (0%)
I-set 6003..6092 CDD:400151 19/107 (18%)
Ig strand B 6020..6024 CDD:409353 0/3 (0%)
Ig strand C 6033..6037 CDD:409353 0/3 (0%)
Ig strand E 6058..6062 CDD:409353 0/3 (0%)
Ig strand F 6072..6077 CDD:409353 0/4 (0%)
Ig 6096..6185 CDD:472250 26/119 (22%)
Ig strand B 6113..6117 CDD:409353 0/3 (0%)
Ig strand C 6126..6130 CDD:409353 2/3 (67%)
Ig strand E 6151..6155 CDD:409353 1/3 (33%)
Ig strand F 6165..6170 CDD:409353 0/4 (0%)
Ig strand G 6178..6181 CDD:409353 0/2 (0%)
I-set 6189..6277 CDD:400151 14/87 (16%)
Ig strand B 6207..6211 CDD:409353 1/3 (33%)
Ig strand C 6220..6224 CDD:409353 0/3 (0%)
Ig strand E 6243..6247 CDD:409353 1/3 (33%)
Ig strand F 6257..6262 CDD:409353 1/4 (25%)
Ig strand G 6270..6273 CDD:409353 0/2 (0%)
I-set 6281..6369 CDD:400151 15/94 (16%)
Ig strand B 6298..6302 CDD:409353 0/3 (0%)
Ig strand C 6311..6315 CDD:409353 0/3 (0%)
Ig strand E 6336..6340 CDD:409353 1/3 (33%)
Ig strand F 6350..6355 CDD:409353 1/4 (25%)
I-set 6374..6462 CDD:400151 23/91 (25%)
Ig strand B 6391..6395 CDD:409353 2/3 (67%)
Ig strand C 6404..6408 CDD:409353 1/3 (33%)
Ig strand E 6429..6433 CDD:409353 1/3 (33%)
Ig strand F 6443..6448 CDD:409353 1/4 (25%)
I-set 6468..6556 CDD:400151 20/91 (22%)
Ig strand B 6484..6488 CDD:409353 0/3 (0%)
Ig strand C 6497..6501 CDD:409353 2/3 (67%)
Ig strand E 6522..6526 CDD:409353 1/5 (20%)
Ig strand F 6536..6541 CDD:409353 1/4 (25%)
Ig strand G 6549..6552 CDD:409353 1/2 (50%)
I-set 6563..6652 CDD:400151 21/90 (23%)
Ig strand B 6580..6584 CDD:409353 0/3 (0%)
Ig strand C 6593..6597 CDD:409353 0/3 (0%)
Ig strand E 6618..6622 CDD:409353 2/3 (67%)
Ig strand F 6632..6637 CDD:409353 2/4 (50%)
Ig strand G 6645..6648 CDD:409353 1/2 (50%)
I-set 6656..6745 CDD:400151 26/93 (28%)
Ig strand B 6673..6677 CDD:409353 0/3 (0%)
Ig strand C 6686..6690 CDD:409353 0/3 (0%)
Ig strand E 6711..6715 CDD:409353 0/5 (0%)
Ig strand F 6725..6730 CDD:409353 2/4 (50%)
Ig strand G 6738..6741 CDD:409353 0/2 (0%)
I-set 6749..6836 CDD:400151 26/91 (29%)
Ig strand C 6780..6784 CDD:409353 1/3 (33%)
Ig strand E 6805..6809 CDD:409353 1/3 (33%)
Ig strand F 6819..6824 CDD:409353 1/4 (25%)
Ig strand G 6832..6835 CDD:409353 1/2 (50%)
I-set 6843..6931 CDD:400151 23/92 (25%)
Ig strand B 6860..6864 CDD:409353 0/3 (0%)
Ig strand C 6873..6877 CDD:409353 1/3 (33%)
Ig strand E 6898..6902 CDD:409353 0/3 (0%)
Ig strand F 6912..6917 CDD:409353 1/4 (25%)
I-set 6936..7026 CDD:400151 24/98 (24%)
Ig strand B 6953..6957 CDD:409353 2/3 (67%)
Ig strand C 6966..6970 CDD:409353 1/9 (11%)
Ig strand E 6992..6996 CDD:409353 1/3 (33%)
Ig strand F 7006..7011 CDD:409353 2/4 (50%)
Ig strand G 7019..7022 CDD:409353 2/4 (50%)
I-set 7032..7119 CDD:400151 27/97 (28%)
Ig strand B 7047..7051 CDD:143224 1/3 (33%)
Ig strand C 7060..7064 CDD:143224 0/3 (0%)
Ig strand E 7085..7089 CDD:143224 0/3 (0%)
Ig strand F 7099..7104 CDD:143224 1/4 (25%)
I-set 7126..7215 CDD:400151 9/88 (10%)
Ig strand B 7143..7147 CDD:409353 0/3 (0%)
Ig strand C 7156..7160 CDD:409353 0/3 (0%)
Ig strand E 7179..7185 CDD:409353 2/5 (40%)
Ig strand F 7195..7200 CDD:409353 1/4 (25%)
Ig strand G 7208..7211 CDD:409353 0/2 (0%)
I-set 7219..7308 CDD:400151 23/98 (23%)
Ig strand B 7236..7240 CDD:409353 0/3 (0%)
Ig strand C 7249..7253 CDD:409353 0/3 (0%)
Ig strand F 7288..7293 CDD:409353 1/4 (25%)
Ig strand G 7301..7304 CDD:409353 1/2 (50%)
I-set 7314..7401 CDD:400151 22/102 (22%)
Ig strand C 7342..7346 CDD:409353 0/3 (0%)
Ig strand E 7367..7371 CDD:409353 2/3 (67%)
Ig strand F 7381..7386 CDD:409353 1/4 (25%)
I-set 7405..7494 CDD:400151 26/93 (28%)
Ig strand B 7423..7426 CDD:409353 0/2 (0%)
Ig strand C 7435..7439 CDD:409353 2/3 (67%)
Ig strand E 7460..7464 CDD:409353 1/3 (33%)
Ig strand F 7474..7479 CDD:409353 1/4 (25%)
Ig strand G 7488..7491 CDD:409353 0/2 (0%)
I-set 7501..7590 CDD:400151 9/88 (10%)
Ig strand B 7518..7522 CDD:409353 1/3 (33%)
Ig strand C 7531..7535 CDD:409353 0/3 (0%)
Ig strand E 7556..7560 CDD:409353 0/3 (0%)
Ig strand F 7570..7575 CDD:409353 0/4 (0%)
Ig strand G 7583..7586 CDD:409353 0/2 (0%)
I-set 7597..7686 CDD:400151 18/88 (20%)
Ig strand C 7627..7631 CDD:409353 0/3 (0%)
Ig strand E 7652..7656 CDD:409353 0/3 (0%)
Ig strand F 7666..7671 CDD:409353 2/4 (50%)
I-set 7690..7780 CDD:400151 34/92 (37%)
Ig strand B 7709..7712 CDD:409353 0/2 (0%)
Ig strand C 7721..7725 CDD:409353 1/3 (33%)
Ig strand E 7746..7750 CDD:409353 1/3 (33%)
Ig strand F 7760..7765 CDD:409353 1/4 (25%)
I-set 7784..7867 CDD:400151 24/83 (29%)
Ig strand B 7801..7805 CDD:409353 0/3 (0%)
Ig strand C 7814..7818 CDD:409353 2/3 (67%)
Ig strand E 7839..7843 CDD:409353 1/3 (33%)
Ig strand F 7853..7858 CDD:409353 2/4 (50%)
I-set 7877..7967 CDD:400151 24/90 (27%)
Ig strand B 7894..7898 CDD:409353 0/3 (0%)
Ig strand C 7907..7911 CDD:409353 0/3 (0%)
Ig strand E 7933..7937 CDD:409353 1/3 (33%)
Ig strand F 7947..7952 CDD:409353 1/4 (25%)
Ig strand G 7960..7963 CDD:409353 0/2 (0%)
I-set 7973..8060 CDD:400151 23/94 (24%)
Ig strand B 7988..7992 CDD:409353 1/3 (33%)
Ig strand C 8001..8005 CDD:409353 0/3 (0%)
Ig strand E 8026..8030 CDD:409353 1/3 (33%)
Ig strand F 8040..8045 CDD:409353 2/4 (50%)
Ig strand G 8053..8056 CDD:409353 1/2 (50%)
I-set 8067..8156 CDD:400151 30/88 (34%)
Ig strand B 8084..8088 CDD:409353 0/3 (0%)
Ig strand C 8097..8101 CDD:409353 0/3 (0%)
Ig strand E 8122..8126 CDD:409353 1/3 (33%)
Ig strand F 8136..8141 CDD:409353 1/4 (25%)
Ig strand G 8149..8152 CDD:409353 0/2 (0%)
I-set 8160..8249 CDD:400151 26/89 (29%)
Ig strand B 8177..8181 CDD:409353 1/3 (33%)
Ig strand C 8190..8194 CDD:409353 1/3 (33%)
Ig strand E 8216..8219 CDD:409353 1/2 (50%)
Ig strand F 8229..8234 CDD:409353 2/4 (50%)
Ig strand G 8242..8245 CDD:409353 1/2 (50%)
I-set 8255..8342 CDD:400151 21/125 (17%)
Ig strand B 8270..8274 CDD:409353 1/3 (33%)
Ig strand C 8283..8287 CDD:409353 0/3 (0%)
Ig strand E 8308..8312 CDD:409353 1/3 (33%)
Ig strand F 8322..8327 CDD:409353 0/4 (0%)
I-set 8346..8435 CDD:400151 28/110 (25%)
Ig strand B 8363..8367 CDD:409353 2/3 (67%)
Ig strand C 8376..8380 CDD:409353 1/3 (33%)
Ig strand E 8401..8405 CDD:409353 3/3 (100%)
Ig strand F 8415..8420 CDD:409353 1/4 (25%)
Ig strand G 8428..8431 CDD:409353 0/2 (0%)
I-set 8442..8530 CDD:400151 24/99 (24%)
Ig strand B 8459..8463 CDD:409353 0/3 (0%)
Ig strand C 8472..8476 CDD:409353 2/3 (67%)
Ig strand E 8497..8501 CDD:409353 0/3 (0%)
Ig strand F 8511..8516 CDD:409353 2/4 (50%)
I-set 8538..8627 CDD:400151 10/88 (11%)
Ig strand B 8555..8559 CDD:409353 0/3 (0%)
Ig strand C 8568..8572 CDD:409353 0/3 (0%)
Ig strand E 8594..8597 CDD:409353 0/2 (0%)
Ig strand F 8607..8612 CDD:409353 1/4 (25%)
Ig strand G 8620..8623 CDD:409353 0/2 (0%)
I-set 8631..8721 CDD:400151 20/132 (15%)
Ig strand B 8649..8653 CDD:409353 2/3 (67%)
Ig strand C 8662..8666 CDD:409353 3/26 (12%)
Ig strand F 8701..8706 CDD:409353 0/4 (0%)
Ig strand G 8714..8717 CDD:409353 0/2 (0%)
I-set 8725..8813 CDD:400151 26/155 (17%)
Ig strand B 8742..8746 CDD:409353 0/3 (0%)
Ig strand C 8755..8759 CDD:409353 2/4 (50%)
Ig strand E 8780..8784 CDD:409353 0/3 (0%)
Ig strand F 8794..8799 CDD:409353 0/4 (0%)
I-set 8818..8908 CDD:400151 21/148 (14%)
Ig strand B 8835..8839 CDD:409353 1/3 (33%)
Ig strand C 8848..8852 CDD:409353 1/3 (33%)
Ig strand E 8874..8878 CDD:409353 1/3 (33%)
Ig strand F 8888..8893 CDD:409353 0/4 (0%)
Ig strand G 8901..8904 CDD:409353 1/2 (50%)
I-set 8913..9001 CDD:400151 24/89 (27%)
Ig strand B 8929..8933 CDD:409353 0/3 (0%)
Ig strand C 8942..8946 CDD:409353 0/3 (0%)
Ig strand E 8967..8971 CDD:409353 2/3 (67%)
Ig strand F 8981..8986 CDD:409353 1/4 (25%)
Ig strand G 8994..8997 CDD:409353 0/2 (0%)
I-set 9008..9097 CDD:400151 16/91 (18%)
Ig strand B 9025..9029 CDD:409353 1/3 (33%)
Ig strand C 9038..9042 CDD:409353 1/3 (33%)
Ig strand E 9061..9067 CDD:409353 0/5 (0%)
Ig strand F 9077..9082 CDD:409353 1/4 (25%)
Ig strand G 9090..9093 CDD:409353 0/2 (0%)
I-set 9101..9190 CDD:400151 15/100 (15%)
Ig strand B 9118..9122 CDD:409353 1/3 (33%)
Ig strand C 9131..9135 CDD:409353 1/3 (33%)
Ig strand E 9156..9160 CDD:409353 1/3 (33%)
Ig strand F 9170..9175 CDD:409353 2/4 (50%)
Ig strand G 9183..9186 CDD:409353 0/2 (0%)
I-set 9196..9283 CDD:400151 11/88 (13%)
Ig strand B 9211..9215 CDD:409353 0/3 (0%)
Ig strand C 9224..9228 CDD:409353 0/3 (0%)
Ig strand E 9249..9253 CDD:409353 2/3 (67%)
Ig strand F 9263..9268 CDD:409353 0/4 (0%)
I-set 9287..9376 CDD:400151 3/11 (27%)
Ig strand B 9304..9308 CDD:409353
Ig strand C 9317..9321 CDD:409353
Ig strand E 9342..9346 CDD:409353
Ig strand F 9356..9361 CDD:409353
Ig strand G 9369..9372 CDD:409353
I-set 9383..9471 CDD:400151
FN3 14031..14484 CDD:442628
FN3 <14354..14744 CDD:442628
FN3 14746..14832 CDD:238020
FN3 14846..14938 CDD:238020
Ig 14959..15068 CDD:472250
Ig strand B 14967..14971 CDD:409353
Ig strand C 14980..14984 CDD:409353
Ig strand E 15034..15038 CDD:409353
Ig strand F 15048..15053 CDD:409353
FN3 15050..15500 CDD:442628
Ig strand G 15061..15064 CDD:409353
FN3 15173..15265 CDD:238020
FN3 15467..15556 CDD:238020
FN3 15565..15657 CDD:238020
Ig_3 15665..15751 CDD:464046
FN3 15711..16229 CDD:442628
FN3 <16128..16535 CDD:442628
FN3 <16546..>16811 CDD:442628
Ig_Titin_like 16803..16882 CDD:409406
Ig strand A 16803..16807 CDD:409406
Ig strand B 16812..16818 CDD:409406
Ig strand C 16824..16830 CDD:409406
Ig strand D 16840..16845 CDD:409406
Ig strand E 16846..16852 CDD:409406
Ig strand F 16861..16869 CDD:409406
Ig strand G 16872..16882 CDD:409406
FN3 16886..16974 CDD:238020
FN3 16987..17080 CDD:238020
Ig 17098..17178 CDD:472250
Ig strand B 17106..17110 CDD:409353
Ig strand C 17119..17123 CDD:409353
Ig strand E 17144..17148 CDD:409353
Ig strand F 17158..17163 CDD:409353
Ig strand G 17171..17174 CDD:409353
FN3 <17200..>17471 CDD:442628
Ig 17500..17576 CDD:472250
Ig strand B 17506..17510 CDD:409353
Ig strand C 17519..17523 CDD:409353
Ig strand E 17542..17546 CDD:409353
Ig strand F 17556..17561 CDD:409353
Ig strand G 17569..17572 CDD:409353
FN3 17580..17667 CDD:238020
FN3 17680..17769 CDD:238020
FN3 17740..>18160 CDD:442628
Ig 18188..18268 CDD:472250
Ig strand B 18196..18200 CDD:409353
Ig strand C 18209..18213 CDD:409353
Ig strand E 18234..18238 CDD:409353
Ig strand F 18248..18253 CDD:409353
Ig strand G 18261..18264 CDD:409353
FN3 18272..18362 CDD:238020
FN3 18371..18462 CDD:238020
Ig 18471..18564 CDD:472250
Ig strand B 18489..18493 CDD:409353
Ig strand C 18502..18506 CDD:409353
Ig strand E 18529..18533 CDD:409353
FN3 18539..18981 CDD:442628
Ig strand F 18543..18548 CDD:409353
Ig strand G 18556..18559 CDD:409353
FN3 18969..19056 CDD:238020
FN3 19069..19158 CDD:238020
Ig 19177..19258 CDD:472250
Ig strand B 19186..19190 CDD:409353
Ig strand C 19199..19203 CDD:409353
Ig strand E 19224..19228 CDD:409353
Ig strand F 19238..19243 CDD:409353
Ig strand G 19251..19254 CDD:409353
FN3 19262..19345 CDD:214495
FN3 <19308..19695 CDD:442628
FN3 19659..19750 CDD:238020
FN3 19758..19847 CDD:238020
FN3 19859..19947 CDD:238020
Ig 19973..20053 CDD:472250
Ig strand B 19981..19985 CDD:409353
Ig strand C 19994..19998 CDD:409353
Ig strand E 20019..20023 CDD:409353
Ig strand F 20033..20038 CDD:409353
Ig strand G 20046..20049 CDD:409353
FN3 20057..20144 CDD:238020
FN3 20154..20242 CDD:238020
FN3 20234..20801 CDD:442628
Ig_Titin_like 20261..20343 CDD:409406
Ig strand A 20261..20265 CDD:409406
Ig strand B 20270..20276 CDD:409406
Ig strand C 20282..20288 CDD:409406
Ig strand D 20301..20306 CDD:409406
Ig strand E 20307..20313 CDD:409406
Ig strand F 20322..20330 CDD:409406
Ig strand G 20333..20343 CDD:409406
FN3 20633..21156 CDD:442628
Ig_Titin_like 21056..21135 CDD:409406
Ig strand A 21056..21060 CDD:409406
Ig strand B 21065..21071 CDD:409406
Ig strand C 21077..21083 CDD:409406
Ig strand D 21093..21098 CDD:409406
Ig strand E 21099..21105 CDD:409406
Ig strand F 21114..21122 CDD:409406
FN3 <21116..21512 CDD:442628
Ig strand G 21125..21135 CDD:409406
Ig_Titin_like 21346..21426 CDD:409406
Ig strand A 21346..21349 CDD:409406
Ig strand B 21354..21360 CDD:409406
Ig strand C 21366..21372 CDD:409406
Ig strand D 21384..21389 CDD:409406
Ig strand E 21390..21396 CDD:409406
Ig strand F 21405..21413 CDD:409406
Ig strand G 21416..21426 CDD:409406
FN3 <21439..>21722 CDD:442628
Ig 21742..21822 CDD:472250
Ig strand B 21750..21754 CDD:409353
Ig strand C 21763..21767 CDD:409353
Ig strand E 21788..21792 CDD:409353
Ig strand F 21802..21807 CDD:409353
Ig strand G 21815..21818 CDD:409353
FN3 21826..21917 CDD:238020
FN3 21926..22018 CDD:238020
FN3 22027..22114 CDD:238020
Ig_Titin_like 22140..22219 CDD:409406
Ig strand A 22140..22144 CDD:409406
Ig strand B 22149..22155 CDD:409406
Ig strand C 22161..22167 CDD:409406
Ig strand D 22177..22182 CDD:409406
Ig strand E 22183..22189 CDD:409406
Ig strand F 22198..22206 CDD:409406
Ig strand G 22209..22219 CDD:409406
FN3 22223..22312 CDD:238020
FN3 22320..22403 CDD:238020
Ig_Titin_like 22427..22508 CDD:409406
Ig strand A 22427..22431 CDD:409406
Ig strand B 22436..22442 CDD:409406
Ig strand C 22448..22454 CDD:409406
Ig strand D 22466..22471 CDD:409406
Ig strand E 22472..22478 CDD:409406
Ig strand F 22487..22495 CDD:409406
FN3 22494..23121 CDD:442628
Ig strand G 22498..22508 CDD:409406
Ig 22823..22904 CDD:472250
Ig strand B 22832..22836 CDD:409353
Ig strand C 22845..22849 CDD:409353
Ig strand E 22870..22874 CDD:409353
Ig strand F 22884..22889 CDD:409353
Ig strand G 22897..22900 CDD:409353
FN3 23109..23197 CDD:238020
Ig_Titin_like 23223..23301 CDD:409406
Ig strand A 23223..23226 CDD:409406
Ig strand B 23231..23237 CDD:409406
Ig strand C 23243..23249 CDD:409406
Ig strand D 23259..23264 CDD:409406
FN3 <23262..23675 CDD:442628
Ig strand E 23265..23271 CDD:409406
Ig strand F 23280..23288 CDD:409406
Ig strand G 23291..23301 CDD:409406
Ig_Titin_like 23510..23589 CDD:409406
Ig strand A 23510..23513 CDD:409406
Ig strand B 23518..23524 CDD:409406
Ig strand C 23530..23536 CDD:409406
Ig strand D 23548..23553 CDD:409406
Ig strand E 23554..23560 CDD:409406
Ig strand F 23569..23577 CDD:409406
Ig strand G 23580..23589 CDD:409406
FN3 <23607..>23880 CDD:442628
Ig 23905..23986 CDD:472250
Ig strand B 23914..23918 CDD:409353
Ig strand C 23927..23931 CDD:409353
Ig strand E 23952..23956 CDD:409353
Ig strand F 23966..23971 CDD:409353
Ig strand G 23979..23982 CDD:409353
FN3 <24032..24454 CDD:442628
Ig_Titin_like 24305..24383 CDD:409406
Ig strand A 24305..24308 CDD:409406
Ig strand B 24313..24319 CDD:409406
Ig strand C 24325..24331 CDD:409406
Ig strand D 24341..24346 CDD:409406
Ig strand E 24347..24353 CDD:409406
Ig strand F 24362..24370 CDD:409406
Ig strand G 24373..24383 CDD:409406
FN3 24484..24567 CDD:238020
Ig 24592..>24653 CDD:472250
Ig strand B 24600..24604 CDD:409353
Ig strand C 24613..24617 CDD:409353
Ig strand E 24638..24642 CDD:409353
FN3 <24675..>24981 CDD:442628
FN3 <24819..25351 CDD:442628
Ig 24987..25069 CDD:472250
Ig strand B 24996..25000 CDD:409353
Ig strand C 25009..25013 CDD:409353
Ig strand E 25035..25039 CDD:409353
Ig strand F 25049..25054 CDD:409353
Ig strand G 25062..25065 CDD:409353
Ig_Titin_like 25387..25466 CDD:409406
Ig strand A 25387..25391 CDD:409406
Ig strand B 25396..25402 CDD:409406
Ig strand C 25408..25414 CDD:409406
Ig strand D 25424..25429 CDD:409406
Ig strand E 25430..25436 CDD:409406
Ig strand F 25445..25453 CDD:409406
Ig strand G 25456..25466 CDD:409406
FN3 25470..25557 CDD:238020
FN3 25567..25650 CDD:238020
Ig_Titin_like 25674..25755 CDD:409406
Ig strand A 25674..25678 CDD:409406
Ig strand B 25683..25689 CDD:409406
Ig strand C 25695..25701 CDD:409406
Ig strand D 25713..25718 CDD:409406
FN3 25719..26201 CDD:442628
Ig strand E 25719..25725 CDD:409406
Ig strand F 25734..25742 CDD:409406
Ig strand G 25745..25755 CDD:409406
Ig_Titin_like 26069..26150 CDD:409406
Ig strand A 26069..26073 CDD:409406
Ig strand B 26078..26084 CDD:409406
Ig strand C 26090..26096 CDD:409406
Ig strand D 26108..26113 CDD:409406
Ig strand E 26114..26120 CDD:409406
Ig strand F 26129..26137 CDD:409406
Ig strand G 26140..26150 CDD:409406
FN3 <26164..>26441 CDD:442628
Ig_Titin_like 26466..26545 CDD:409406
Ig strand A 26466..26470 CDD:409406
Ig strand B 26475..26481 CDD:409406
Ig strand C 26487..26493 CDD:409406
Ig strand D 26503..26508 CDD:409406
Ig strand E 26509..26515 CDD:409406
Ig strand F 26524..26532 CDD:409406
Ig strand G 26535..26545 CDD:409406
FN3 26549..26640 CDD:238020
FN3 26646..26729 CDD:238020
Ig_Titin_like 26756..26837 CDD:409406
Ig strand A 26756..26760 CDD:409406
Ig strand B 26765..26771 CDD:409406
Ig strand C 26777..26783 CDD:409406
Ig strand D 26795..26800 CDD:409406
FN3 26798..27520 CDD:442628
Ig strand E 26801..26807 CDD:409406
Ig strand F 26816..26824 CDD:409406
Ig strand G 26827..26837 CDD:409406
Ig_Titin_like 27152..27232 CDD:409406
Ig strand A 27152..27156 CDD:409406
Ig strand B 27161..27167 CDD:409406
Ig strand C 27173..27179 CDD:409406
Ig strand D 27191..27196 CDD:409406
Ig strand E 27197..27203 CDD:409406
Ig strand F 27212..27220 CDD:409406
Ig strand G 27223..27232 CDD:409406
Ig_Titin_like 27552..27633 CDD:409406
Ig strand A 27552..27555 CDD:409406
Ig strand B 27560..27566 CDD:409406
Ig strand C 27572..27578 CDD:409406
Ig strand D 27590..27595 CDD:409406
Ig strand E 27596..27602 CDD:409406
Ig strand F 27611..27619 CDD:409406
Ig strand G 27622..27633 CDD:409406
FN3 27637..27726 CDD:238020
FN3 27734..27825 CDD:238020
Ig 27844..27923 CDD:472250
Ig strand B 27852..27856 CDD:409353
Ig strand C 27865..27869 CDD:409353
Ig strand E 27890..27894 CDD:409353
FN3 <27891..>28171 CDD:442628
Ig strand F 27904..27909 CDD:409353
Ig strand G 27917..27920 CDD:409353
Ig 28239..28319 CDD:472250
Ig strand B 28247..28251 CDD:409353
Ig strand C 28260..28264 CDD:409353
Ig strand E 28285..28289 CDD:409353
Ig strand F 28299..28304 CDD:409353
Ig strand G 28312..28315 CDD:409353
FN3 28330..28415 CDD:238020
FN3 <28390..28749 CDD:442628
FN3 28720..28812 CDD:238020
FN3 28817..28900 CDD:238020
FN3 28873..29443 CDD:442628
Ig_Titin_like 28927..28998 CDD:409406
Ig strand A 28927..28931 CDD:409406
Ig strand B 28936..28942 CDD:409406
Ig strand C 28948..28954 CDD:409406
Ig strand D 28966..28971 CDD:409406
Ig strand E 28972..28978 CDD:409406
Ig strand F 28987..28995 CDD:409406
FN3 <29472..29841 CDD:442628
Ig_Titin_like 29727..29805 CDD:409406
Ig strand A 29727..29730 CDD:409406
Ig strand B 29735..29741 CDD:409406
Ig strand C 29747..29753 CDD:409406
Ig strand D 29763..29768 CDD:409406
Ig strand E 29769..29775 CDD:409406
Ig strand F 29784..29792 CDD:409406
Ig strand G 29795..29805 CDD:409406
FN3 29809..29900 CDD:238020
FN3 29906..29999 CDD:238020
Ig 30018..30099 CDD:472250
Ig strand B 30027..30031 CDD:409353
Ig strand C 30040..30044 CDD:409353
Ig strand E 30065..30069 CDD:409353
Ig strand F 30079..30084 CDD:409353
FN3 30087..>30399 CDD:442628
Ig strand G 30092..30095 CDD:409353
Ig_Titin_like 30417..30495 CDD:409406
Ig strand A 30417..30420 CDD:409406
Ig strand B 30425..30431 CDD:409406
Ig strand C 30437..30443 CDD:409406
Ig strand D 30453..30458 CDD:409406
Ig strand E 30459..30465 CDD:409406
Ig strand F 30474..30482 CDD:409406
Ig strand G 30485..30495 CDD:409406
FN3 30499..30582 CDD:214495
FN3 <30544..30865 CDD:442628
Ig 30909..30988 CDD:472250
Ig strand B 30917..30921 CDD:409353
Ig strand C 30930..30934 CDD:409353
Ig strand E 30955..30959 CDD:409353
Ig strand F 30970..30975 CDD:409353
FN3 <30971..31289 CDD:442628
Ig strand G 30983..30986 CDD:409353
FN3 31096..31189 CDD:238020
Ig 31308..31389 CDD:472250
Ig strand B 31316..31320 CDD:409353
Ig strand C 31329..31333 CDD:409353
Ig strand E 31354..31358 CDD:409353
Ig strand F 31369..31374 CDD:409353
Ig strand G 31382..31385 CDD:409353
FN3 31393..31484 CDD:238020
STKc_Titin 31520..31796 CDD:271006
IgI_Titin_M1-like 31839..31928 CDD:409521
Ig strand A 31840..31843 CDD:409521
Ig strand A' 31846..31849 CDD:409521
Ig strand B 31853..31862 CDD:409521
Ig strand C 31868..31874 CDD:409521
Ig strand C' 31876..31879 CDD:409521
Ig strand D 31885..31890 CDD:409521
Ig strand E 31894..31900 CDD:409521
Ig strand F 31907..31915 CDD:409521
Ig strand G 31918..31927 CDD:409521
I-set 31960..32052 CDD:400151
Ig strand B 31977..31981 CDD:409353
Ig strand C 31990..31994 CDD:409353
Ig strand E 32018..32022 CDD:409353
Ig strand F 32032..32037 CDD:409353
Ig strand G 32045..32048 CDD:409353
I-set 32065..32155 CDD:400151
Ig strand B 32082..32086 CDD:409353
Ig strand C 32095..32099 CDD:409353
Ig strand E 32121..32125 CDD:409353
Ig strand F 32135..32140 CDD:409353
Ig strand G 32148..32151 CDD:409353
Ig 32641..32728 CDD:472250
Ig strand B 32658..32662 CDD:409353
Ig strand C 32671..32675 CDD:409353
Ig strand E 32696..32700 CDD:409353
Ig strand F 32710..32715 CDD:409353
Ig strand G 32723..32726 CDD:409353
Ig 32827..32916 CDD:472250
Ig strand B 32845..32849 CDD:143224
Ig strand C 32858..32862 CDD:143224
Ig strand E 32883..32887 CDD:143224
Ig strand F 32897..32902 CDD:143224
Ig strand G 32910..32913 CDD:143224
Ig 32982..33062 CDD:472250
Ig strand B 32997..33001 CDD:409353
Ig strand C 33012..33016 CDD:409353
Ig strand E 33038..33042 CDD:409353
Ig strand F 33052..33057 CDD:409353
Ig 33132..33212 CDD:472250
Ig strand B 33142..33146 CDD:409353
Ig strand C 33153..33157 CDD:409353
Ig strand E 33178..33182 CDD:409353
Ig strand F 33192..33197 CDD:409353
I-set 33220..33309 CDD:400151
Ig strand B 33237..33241 CDD:409353
Ig strand C 33250..33254 CDD:409353
Ig strand E 33275..33279 CDD:409353
Ig strand F 33289..33294 CDD:409353
Ig strand G 33302..33305 CDD:409353
I-set 33399..33491 CDD:400151
Ig strand B 33416..33420 CDD:409353
Ig strand C 33429..33433 CDD:409353
Ig strand E 33457..33461 CDD:409353
Ig strand F 33471..33476 CDD:409353
Ig strand G 33484..33487 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.