| Sequence 1: | NP_001097440.1 | Gene: | Unc-89 / 3346201 | FlyBaseID: | FBgn0053519 | Length: | 4218 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_006733.1 | Gene: | PSKH1 / 5681 | HGNCID: | 9529 | Length: | 424 | Species: | Homo sapiens |
| Alignment Length: | 265 | Identity: | 92/265 - (34%) |
|---|---|---|---|
| Similarity: | 142/265 - (53%) | Gaps: | 9/265 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 3181 RYQDKYDIGDELGRGTQGITYHAVERSSGDNYAAKIMYGR-PELRPFMLNELEMMNTFNHKNLIR 3244
Fly 3245 PYDAYDTDRSVTLIMELAAGGELVRDNLLRRDYYTERDIAHYIRQTLWGLEHMHEMGVGHMGLTI 3309
Fly 3310 KDLLISVVGGDI-IKVSDFGL--SRKINRHNLSTLDYGMPEFVSPEVVNKEGVNFSHDMWTVGLI 3371
Fly 3372 TYVLLGGHNPFLGIDDRET--LTKIREGRWDFKDEIWTHISDDGRDFISRLLLYSPEERMDVKTA 3434
Fly 3435 LKHPW 3439 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Unc-89 | NP_001097440.1 | RhoGEF | 90..260 | CDD:238091 | |
| PH_unc89 | 275..388 | CDD:270134 | |||
| Atrophin-1 | <493..690 | CDD:331285 | |||
| TonB_N | 502..>596 | CDD:318287 | |||
| I-set | 1017..1108 | CDD:333254 | |||
| I-set | 1123..1212 | CDD:254352 | |||
| I-set | <1236..1299 | CDD:333254 | |||
| I-set | 1313..1403 | CDD:254352 | |||
| Ig_3 | 1406..1487 | CDD:316449 | |||
| I-set | 1499..1595 | CDD:254352 | |||
| I-set | 1599..1690 | CDD:333254 | |||
| I-set | 1694..1786 | CDD:254352 | |||
| I-set | <1836..1903 | CDD:333254 | |||
| I-set | 1922..2005 | CDD:333254 | |||
| I-set | 2018..2108 | CDD:333254 | |||
| I-set | 2113..2214 | CDD:333254 | |||
| I-set | 2220..2302 | CDD:254352 | |||
| I-set | 2318..2408 | CDD:254352 | |||
| I-set | 2415..2506 | CDD:254352 | |||
| I-set | 2519..2608 | CDD:254352 | |||
| I-set | 2615..2696 | CDD:254352 | |||
| I-set | 2717..2805 | CDD:254352 | |||
| FN3 | 2834..2925 | CDD:238020 | |||
| I-set | <2996..3063 | CDD:333254 | |||
| I-set | 3067..3157 | CDD:333254 | |||
| PK_Unc-89_rpt1 | 3182..3440 | CDD:271011 | 91/264 (34%) | ||
| I-set | 3654..3744 | CDD:333254 | |||
| FN3 | 3748..3840 | CDD:238020 | |||
| STKc_Unc-89_rpt2 | 3893..4151 | CDD:271014 | |||
| PSKH1 | NP_006733.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 56..80 | ||
| STKc_PSKH1 | 96..355 | CDD:270989 | 91/262 (35%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 378..407 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0032 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||