DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Unc-89 and zgc:171470

DIOPT Version :9

Sequence 1:NP_001097440.1 Gene:Unc-89 / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:NP_001104655.1 Gene:zgc:171470 / 565848 ZFINID:ZDB-GENE-080204-4 Length:374 Species:Danio rerio


Alignment Length:524 Identity:99/524 - (18%)
Similarity:163/524 - (31%) Gaps:214/524 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly  1103 SAQLAVGQAPGHDETKTNTEPAFLVSLKDAEMIENTLFRF-----MVKIIGDPKPRVKFYKDE-- 1160
            ||..||..:..|           :.:|||:.:|.:..|::     ::|:..: |..|: ::||  
Zfish    22 SADWAVTYSSSH-----------ICALKDSSVIMSCTFKYPTGHQIMKVFWN-KDFVE-HRDELA 73

  Fly  1161 --KEILETNDRIQIIRDKDYLGFYELVIADVQKTDAGTYSCK-ATNKHGE--ANCEAIATTVED- 1219
              .|..|.:.|:|.:.||......:|.:  |.|.|...|..: .|::.|.  |....:..:|.| 
Zfish    74 DLSEHPEYSQRLQYLGDKQQNCTVKLSL--VTKKDEHMYYFRFITDQPGGKWAGYPGVRLSVTDL 136

  Fly  1220 --KNPFGALSGQIL--------PAGEKPVFQWKRNGEEFDPEERFKVLFGEDEDSLALVFQHVKP 1274
              ::|.....|..:        ...:.|.|.|.||.|..            .|.|..|:...|:.
Zfish   137 QLESPERVTEGDSVRLTCRSSCNLTDTPTFIWYRNSERM------------IERSSELLLHSVRR 189

  Fly  1275 EDAGIYTCVAQTSTGNISCSAELSVQGAIQTLNREPEKPTLVIEHREANASIGGSAIL------E 1333
            ||||.|.|...   |:...|.|:.:              .::...:..:.||.|||::      .
Zfish   190 EDAGRYRCAVH---GHTLTSPEIYL--------------NVMYPPKSVSVSISGSAVIVSGDSVT 237

  Fly  1334 LQCKGFPKP--AVQWKHDGEVIQVDDRHKFMYEDEESMS----LVIKNVDTVDAGVYTIEAINEL 1392
            |.|.....|  .:.|                ::.|.|:.    ..|..:.:.|:|.|...|.|.|
Zfish   238 LNCSSDSNPPAEISW----------------FKGETSVGSGRIFNISKISSGDSGEYKCRARNAL 286

  Fly  1393 GQDESS-INLVVKAPPKIKKITDITCSAGETIKMEIEVEGFPQPTVQVTNNGKDVTAESNVKISS 1456
            |:..|. :.|.|:.||                 |.:                       :|.||.
Zfish   287 GEKYSDPVTLDVQYPP-----------------MNV-----------------------SVSISG 311

  Fly  1457 SSIGKSLEKVVVEVKEIKLSQAGNYSIKATNDLSQTSEYWSCTVKSKPVIVKNFESEYIHGEKEN 1521
            |::..|...|.:                            ||:                      
Zfish   312 SAVIMSGHSVTL----------------------------SCS---------------------- 326

  Fly  1522 VQMTVRIDAYPEAKLTWYHDETEIKITDSKYTVSSDGNAYTLKITGATRV-DAGKYTVKATNEHG 1585
                  .|:.|.|:::|:..||                     :.|..|: ...|...:|.|.||
Zfish   327 ------SDSNPPAQISWFKGET---------------------LVGFGRIFSISKIRCRARNVHG 364

  Fly  1586 SATS 1589
            ...|
Zfish   365 EKYS 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Unc-89NP_001097440.1 RhoGEF 90..260 CDD:238091
PH_unc89 275..388 CDD:270134
Atrophin-1 <493..690 CDD:331285
TonB_N 502..>596 CDD:318287
I-set 1017..1108 CDD:333254 2/4 (50%)
I-set 1123..1212 CDD:254352 24/100 (24%)
I-set <1236..1299 CDD:333254 19/62 (31%)
I-set 1313..1403 CDD:254352 21/102 (21%)
Ig_3 1406..1487 CDD:316449 9/80 (11%)
I-set 1499..1595 CDD:254352 14/92 (15%)
I-set 1599..1690 CDD:333254
I-set 1694..1786 CDD:254352
I-set <1836..1903 CDD:333254
I-set 1922..2005 CDD:333254
I-set 2018..2108 CDD:333254
I-set 2113..2214 CDD:333254
I-set 2220..2302 CDD:254352
I-set 2318..2408 CDD:254352
I-set 2415..2506 CDD:254352
I-set 2519..2608 CDD:254352
I-set 2615..2696 CDD:254352
I-set 2717..2805 CDD:254352
FN3 2834..2925 CDD:238020
I-set <2996..3063 CDD:333254
I-set 3067..3157 CDD:333254
PK_Unc-89_rpt1 3182..3440 CDD:271011
I-set 3654..3744 CDD:333254
FN3 3748..3840 CDD:238020
STKc_Unc-89_rpt2 3893..4151 CDD:271014
zgc:171470NP_001104655.1 Ig 25..114 CDD:299845 24/103 (23%)
IG_like 140..213 CDD:214653 21/101 (21%)
Ig_2 140..>197 CDD:290606 17/68 (25%)
Ig_2 224..298 CDD:290606 20/89 (22%)
IG_like 225..298 CDD:214653 19/88 (22%)
IG_like 310..373 CDD:214653 20/136 (15%)
Ig_2 314..373 CDD:290606 18/132 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4475
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.