Sequence 1: | NP_001097440.1 | Gene: | Unc-89 / 3346201 | FlyBaseID: | FBgn0053519 | Length: | 4218 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001017607.1 | Gene: | camk4 / 550270 | ZFINID: | ZDB-GENE-050417-76 | Length: | 364 | Species: | Danio rerio |
Alignment Length: | 267 | Identity: | 82/267 - (30%) |
---|---|---|---|
Similarity: | 149/267 - (55%) | Gaps: | 8/267 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 3177 SKQLRYQDKYDIGDELGRGTQGITYHAVERSSGDNYAAKIMYGRPELRPFMLNELEMMNTFNHKN 3241
Fly 3242 LIRPYDAYDTDRSVTLIMELAAGGELVRDNLLRRDYYTERDIAHYIRQTLWGLEHMHEMGVGHMG 3306
Fly 3307 LTIKDLLISVVGGDI-IKVSDFGLSRKINRHNLSTLDYGMPEFVSPEVVNKEGVNFSHDMWTVGL 3370
Fly 3371 ITYVLLGGHNPFLGIDDR---ETLTKIREGRWDFKDEIWTHISDDGRDFISRLLLYSPEERMDVK 3432
Fly 3433 TALKHPW 3439 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Unc-89 | NP_001097440.1 | RhoGEF | 90..260 | CDD:238091 | |
PH_unc89 | 275..388 | CDD:270134 | |||
Atrophin-1 | <493..690 | CDD:331285 | |||
TonB_N | 502..>596 | CDD:318287 | |||
I-set | 1017..1108 | CDD:333254 | |||
I-set | 1123..1212 | CDD:254352 | |||
I-set | <1236..1299 | CDD:333254 | |||
I-set | 1313..1403 | CDD:254352 | |||
Ig_3 | 1406..1487 | CDD:316449 | |||
I-set | 1499..1595 | CDD:254352 | |||
I-set | 1599..1690 | CDD:333254 | |||
I-set | 1694..1786 | CDD:254352 | |||
I-set | <1836..1903 | CDD:333254 | |||
I-set | 1922..2005 | CDD:333254 | |||
I-set | 2018..2108 | CDD:333254 | |||
I-set | 2113..2214 | CDD:333254 | |||
I-set | 2220..2302 | CDD:254352 | |||
I-set | 2318..2408 | CDD:254352 | |||
I-set | 2415..2506 | CDD:254352 | |||
I-set | 2519..2608 | CDD:254352 | |||
I-set | 2615..2696 | CDD:254352 | |||
I-set | 2717..2805 | CDD:254352 | |||
FN3 | 2834..2925 | CDD:238020 | |||
I-set | <2996..3063 | CDD:333254 | |||
I-set | 3067..3157 | CDD:333254 | |||
PK_Unc-89_rpt1 | 3182..3440 | CDD:271011 | 80/262 (31%) | ||
I-set | 3654..3744 | CDD:333254 | |||
FN3 | 3748..3840 | CDD:238020 | |||
STKc_Unc-89_rpt2 | 3893..4151 | CDD:271014 | |||
camk4 | NP_001017607.1 | STKc_CaMKIV | 25..318 | CDD:270987 | 80/262 (31%) |
Pkinase | 29..283 | CDD:278497 | 79/258 (31%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0032 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |