DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obsc and stk17a

DIOPT Version :10

Sequence 1:NP_001097440.1 Gene:Obsc / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:NP_001016460.1 Gene:stk17a / 549214 XenbaseID:XB-GENE-5757566 Length:417 Species:Xenopus tropicalis


Alignment Length:398 Identity:116/398 - (29%)
Similarity:182/398 - (45%) Gaps:72/398 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  3173 PYVRSKQLRYQDKYDI--GDELGRGTQGITYHAVERSSGDNYAAKIMYGR---PELRPFMLNELE 3232
            |.:..:...:...|.|  |.|||||...:....||:.:|..:|||.|..|   .:.|..:::|:.
 Frog    40 PSIPIRSQPFSSAYSISPGHELGRGKFAVVRKCVEKETGKEFAAKFMRKRRKGQDCRMEIIHEIA 104

  Fly  3233 MMNTFNHKN-LIRPYDAYDTDRSVTLIMELAAGGELVRDNLL-RRDYYTERDIAHYIRQTLWGLE 3295
            ::....... :|:.::.|:|...:.|::|.|||||:....:. |.:.:.|:|:...:||.|.|:.
 Frog   105 VLELARGSPWVIKLHEVYETATEMILVLEYAAGGEIFNQCVAEREEAFKEKDVRRLMRQILKGVA 169

  Fly  3296 HMHEMGVGHMGLTIKDLLISVVG--GDIIKVSDFGLSRKINRHNLSTLDYGMPEFVSPEVVNKEG 3358
            .:|...|.|:.|..:::|::...  || |||.||||||.:|.:.......|.||:|:||:::.|.
 Frog   170 FLHRHNVVHLDLKPQNVLLTSACPLGD-IKVVDFGLSRILNNNEELREIMGTPEYVAPEILSYEP 233

  Fly  3359 VNFSHDMWTVGLITYVLLGGHNPFLGIDDRETLTKIREGRWDFKDEIWTHISDDGRDFISRLLLY 3423
            ::.:.|||:||::.||:|.|.:||||.|.::|...|.:....:..|.:..|||...|||..||:.
 Frog   234 ISTATDMWSVGVLAYVMLTGTSPFLGDDKQQTFLNISQLNVTYSSEEFDGISDSAIDFIKALLIR 298

  Fly  3424 SPEERMDVKTALKHPWFFMLDRPVYDHDYQIGTDRLRNYYDHFRDWYANASCKNYFRRRRLSGCF 3488
            .||.|......|:|||....|.|                     |.||:|               
 Frog   299 KPEARSSAVDCLQHPWLAQGDLP---------------------DPYASA--------------- 327

  Fly  3489 QHPSKMVYPPGHVYTPEN----------TPEP---LPEPRIRAKREEVVSKYLHPDYELGLI--- 3537
               ...|....||...|.          :|||   :||...:...||::   :...|.||..   
 Frog   328 ---MNSVQESNHVTQEEENAEDELTQAMSPEPVTSIPEAEGQTVAEELI---VMASYTLGQCRQT 386

  Fly  3538 ----QSES 3541
                ||||
 Frog   387 ELEKQSES 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ObscNP_001097440.1 RhoGEF 90..260 CDD:238091
PH_unc89 275..388 CDD:270134
Not5 <477..>652 CDD:444384
Ig 1017..1108 CDD:472250
Ig strand B 1034..1038 CDD:409353
Ig strand C 1046..1050 CDD:409353
Ig strand E 1074..1078 CDD:409353
Ig strand F 1088..1093 CDD:409353
Ig strand G 1101..1104 CDD:409353
I-set 1123..1212 CDD:400151
Ig strand B 1140..1144 CDD:409353
Ig strand C 1153..1157 CDD:409353
Ig strand E 1182..1186 CDD:409353
Ig strand F 1196..1201 CDD:409353
Ig strand G 1209..1212 CDD:409353
Ig <1236..1299 CDD:472250
Ig strand C 1238..1242 CDD:409353
Ig strand E 1259..1269 CDD:409353
Ig strand F 1279..1284 CDD:409353
Ig strand G 1292..1295 CDD:409353
I-set 1313..1403 CDD:400151
Ig strand B 1330..1334 CDD:409353
Ig strand C 1343..1347 CDD:409353
Ig strand E 1369..1373 CDD:409353
Ig strand F 1383..1388 CDD:409353
Ig strand G 1396..1399 CDD:409353
Ig_3 1406..1487 CDD:464046
I-set 1499..1595 CDD:400151
Ig strand B 1522..1526 CDD:409353
Ig strand C 1535..1539 CDD:409353
Ig strand E 1561..1565 CDD:409353
Ig strand F 1575..1580 CDD:409353
Ig strand G 1588..1591 CDD:409353
Ig 1599..1690 CDD:472250
Ig strand B 1617..1621 CDD:409353
Ig strand C 1630..1634 CDD:409353
Ig strand E 1656..1660 CDD:409353
Ig strand F 1670..1675 CDD:409353
Ig strand G 1683..1686 CDD:409353
I-set 1694..1786 CDD:400151
Ig strand B 1711..1715 CDD:409353
Ig strand C 1724..1728 CDD:409353
Ig strand E 1752..1756 CDD:409353
Ig strand F 1766..1771 CDD:409353
Ig strand G 1779..1782 CDD:409353
Ig <1836..1903 CDD:472250
Ig strand C 1846..1850 CDD:409353
Ig strand E 1871..1875 CDD:409353
Ig strand F 1885..1890 CDD:409353
Ig 1922..2005 CDD:472250
Ig strand B 1933..1937 CDD:409353
Ig strand C 1946..1950 CDD:409353
Ig strand E 1971..1984 CDD:409353
Ig strand F 1994..1999 CDD:409353
Ig 2018..2108 CDD:472250
Ig strand B 2034..2038 CDD:409353
Ig strand C 2047..2051 CDD:409353
Ig strand E 2074..2078 CDD:409353
Ig strand F 2088..2093 CDD:409353
Ig strand G 2101..2104 CDD:409353
Ig 2113..2214 CDD:472250
Ig strand B 2130..2134 CDD:409353
Ig strand C 2143..2147 CDD:409353
Ig strand E 2176..2185 CDD:409353
Ig strand F 2195..2200 CDD:409353
I-set 2220..2302 CDD:400151
Ig strand B 2238..2242 CDD:409353
Ig strand C 2251..2255 CDD:409353
Ig strand E 2277..2281 CDD:409353
Ig strand F 2291..2296 CDD:409353
Ig strand G 2304..2307 CDD:409353
I-set 2318..2408 CDD:400151
Ig strand B 2335..2339 CDD:409353
Ig strand C 2348..2352 CDD:409353
Ig strand E 2374..2378 CDD:409353
Ig strand F 2388..2393 CDD:409353
Ig 2415..2506 CDD:472250
Ig strand B 2432..2436 CDD:409353
Ig strand C 2445..2449 CDD:409353
Ig strand E 2472..2476 CDD:409353
Ig strand F 2486..2491 CDD:409353
Ig strand G 2499..2502 CDD:409353
I-set 2519..2608 CDD:400151
Ig strand B 2536..2540 CDD:409353
Ig strand C 2549..2553 CDD:409353
Ig strand E 2574..2578 CDD:409353
Ig strand F 2588..2593 CDD:409353
I-set 2615..2696 CDD:400151
Ig strand B 2632..2636 CDD:409353
Ig strand C 2645..2649 CDD:409353
Ig strand E 2670..2674 CDD:409353
Ig strand F 2684..2689 CDD:409353
Ig strand G 2697..2700 CDD:409353
I-set 2717..2805 CDD:400151
Ig strand B 2734..2738 CDD:409353
Ig strand C 2747..2751 CDD:409353
Ig strand E 2773..2777 CDD:409353
Ig strand F 2787..2792 CDD:409353
Ig strand G 2800..2803 CDD:409353
FN3 2834..2925 CDD:238020
Ig <2996..3063 CDD:472250
Ig strand C 3003..3007 CDD:409353
Ig strand E 3029..3033 CDD:409353
Ig strand F 3043..3048 CDD:409353
Ig strand G 3056..3059 CDD:409353
Ig 3067..3157 CDD:472250
Ig strand B 3085..3088 CDD:409353
Ig strand C 3097..3101 CDD:409353
Ig strand E 3123..3127 CDD:409353
Ig strand F 3137..3142 CDD:409353
Ig strand G 3150..3153 CDD:409353
PK_Unc-89_rpt1 3182..3440 CDD:271011 90/266 (34%)
Ig 3654..3744 CDD:472250
Ig strand B 3671..3675 CDD:409353
Ig strand C 3684..3688 CDD:409353
Ig strand E 3710..3714 CDD:409353
Ig strand F 3724..3729 CDD:409353
Ig strand G 3737..3740 CDD:409353
FN3 3748..3840 CDD:238020
STKc_Unc-89_rpt2 3893..4151 CDD:271014
stk17aNP_001016460.1 STKc_DRAK1 45..315 CDD:271099 90/270 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.