DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obsc and Hmcn1

DIOPT Version :10

Sequence 1:NP_001097440.1 Gene:Obsc / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:XP_006529820.1 Gene:Hmcn1 / 545370 MGIID:2685047 Length:5658 Species:Mus musculus


Alignment Length:4136 Identity:844/4136 - (20%)
Similarity:1400/4136 - (33%) Gaps:1249/4136 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 LKLPIQRINDYQLLFKDFIKYSLSLKENVKDLERALELMLSVPSR-AYDNRFLSSIEGCRGNI-- 277
            :|:...|::|..:    ::..:.::..||   .::::|.:.||.: .:.||.:....|.|.:|  
Mouse  1135 MKITETRVSDSGM----YLCVATNIAGNV---TQSVKLSVHVPPKIQHGNRHIKVQVGQRVDILC 1192

  Fly   278 ------------YKLGRLLLHAWCNVVDKEGKAHDRYCFLFKSRILVTKVRKISENRSVFILQNI 330
                        :|.||..|         :|..|..           :....:|..::|.....:
Mouse  1193 NAHGSPPPVITWFKSGRPFL---------DGAQHPG-----------SPDGTLSIEQAVISDAGV 1237

  Fly   331 VKLPLCNIELKADEKQIHLSLKAPE-----------------ANSFLPIDIKPHG-PEAHLTWFN 377
            ......|| ..:||.::.|.::.|.                 ||..:.......| |:..:.|. 
Mouse  1238 YTCAATNI-AGSDEAEVTLHVQEPPSVEDLQPPFNTPFQERLANQRIEFPCPAKGTPKPTIKWL- 1300

  Fly   378 EISSHINQDVTLQE-------------------HNADDLKVDASQIASESE----LILHLPQ--R 417
                |..::||.||                   ||..:....|...|..:|    |.:|:|.  |
Mouse  1301 ----HNGREVTGQEPGVSILEDGALLVIASVTPHNNGEYICVAVNEAGTTERKYNLKVHVPPVIR 1361

  Fly   418 AEAHDPNLSVRPSDVAENYFLSKET--------KERLQHEQQELLKL--EQEAIELYK-KQQSSK 471
            .:.|..|:||..|.:|..|...:.|        |:.:|..:...:::  ..:.::|:| ..:.:.
Mouse  1362 DKEHVTNVSVLTSQLASLYCEVEGTPSPVITWYKDDIQVTESSTVQIVNNGKILKLFKVSAEDAG 1426

  Fly   472 SVSSKTESVEITSSQVKSSSEVRKVVSPPPPPQAQVKEVTPV---KVVSSPPPPKEITPAKVATP 533
            ..|.|  ::.|..:..|..| |..:|.|.....:...||:.|   .|....|......||.....
Mouse  1427 RYSCK--AINIAGTSQKDFS-VNVLVPPSILGASSPSEVSVVLNHNVTLQCPGTGVPFPAIHWFK 1488

  Fly   534 PPQPQVVTSPVKEVAPPPQPRAVASPAK------EVTPSQSEPVKAPSPIKEVRKE--VPPS--- 587
            ..:|..:..|..|::...|...:.:..:      :.|.|.:    |....|:::..  ||||   
Mouse  1489 DGKPLFLGDPNIELSDRGQSLHLRNARRSDKGRYQCTVSNA----AGKQAKDIKLTVYVPPSIKG 1549

  Fly   588 ASHSKEVEALVATEIRESLTETRS------TVVESGQSSEIREEIVVTEESS---LEGKQVVALE 643
            .:.:.|:.||:.:.::.. .|||.      |..:.||        |||..|.   ::..|::.::
Mouse  1550 GNITTEISALLNSIVKLE-CETRGLPVPAITWYKDGQ--------VVTSSSQALYIDKGQLLHIQ 1605

  Fly   644 REPSPCSIP----------------KIQVYRPVECENPVVTKHKPIELKDIVGYSESLRDGDTAP 692
            |.....|..                .:.:|.|...|..:..   |...:.|:|.|..|.    ..
Mouse  1606 RAQVSDSATYTCHAANVAGTAEKSFHVDIYVPPTIEGDLTA---PSNKQVIIGQSLILE----CK 1663

  Fly   693 AGGSP-----GRQQGYSANITDHASLTIWNNRL-----------------ANIAGDRSGANQHLQ 735
            |.|:|     ..:.|.....:|:..:.....:|                 .::||:|.       
Mouse  1664 AAGNPPPILTWLKDGVPVKASDNIHIEAGGKKLEILSALEVDRGQYICVATSVAGERE------- 1721

  Fly   736 QSGPPPPPIPPNFTRMPGFFQPLPLIAYETTIEILIVKARPPS---------------------- 778
                                     |.||  :::|:    ||:                      
Mouse  1722 -------------------------IKYE--VDVLV----PPAVEGGEETSYFIVLANNLLELDC 1755

  Fly   779 -PPPPPPPTIK--------------RVLVHTESLEQKTQNFFEGIYDAASSDTSLRNAKQKIRSI 828
             ....|||||.              ::|::...|.         |..|..|||.|....      
Mouse  1756 QVSGSPPPTIMWLKGGQLIDERDGFKILLNGRKLV---------IAQAQVSDTGLYQCV------ 1805

  Fly   829 KSTVLKSKDSTNYAQDTVQKAKARDF---LHIFTPPVKKRPIYE---IVEEPVNIFELEGDYTES 887
                     :||.|.|     ..::|   :|: .|.:|...:.|   :..:||.:        :.
Mouse  1806 ---------ATNIAGD-----HRKEFEVTVHV-PPTIKSSDLPEKTVVRYKPVTL--------QC 1847

  Fly   888 IADDFREPSADFEARGQSVGGMDDYYSGYSRASTRRYETKTRDYDRGTSYDSTVERSQYGISSRR 952
            ||:....||..:....|.|             :|.....|..|.|.|.        .:.|...||
Mouse  1848 IANGIPNPSITWLKDDQPV-------------NTAHGNLKDLDADSGP--------RRRGKEDRR 1891

  Fly   953 DRSSVDKVEARSSLLATGRTESRAASRAESRAESRASYSVAESRAGIRSSSRLQEDRPLRSVDKP 1017
            ..::|..:::...:|...:.....|.|....|.:.|..:...::..:.....|.:...:|  ::.
Mouse  1892 WHTAVASIQSSGRVLQIAKALLEDAGRYTCVATNAAGEAHQHTQLHVHEPPSLDDAGKMR--NET 1954

  Fly  1018 VVVKMLKSVQVEPGETAHFEIQFKDQPGLVTWLKDNKPLEDRLADRITQTAAPMNSYR-LDIKNC 1081
            |||.  ..:|:|...|.      |..| ::||.||:.||..      :.:||.:...: |:|.:.
Mouse  1955 VVVN--NPIQLECKATG------KPLP-VITWYKDSHPLSG------SASAAFLKRGQVLEIGSA 2004

  Fly  1082 SETDAGTYTIRAQSASETTTVSAQLAVGQAPGHDETKTNTEPAFLVSLKDAEMIENTLFRFMVKI 1146
            ..:|||.|...|.:::..|.:...|.|           :..|:...|....|::.|.|.|...:.
Mouse  2005 QISDAGIYKCVAINSAGATELFYSLQV-----------HVPPSISGSSSMVEVVVNNLARLECEA 2058

  Fly  1147 IGDPKPRVKFYKDEKEILETNDRIQIIRDKDYLGFYELVIADVQKTDAGTYSCKATNKHGEANCE 1211
            .|.|.|.:.:.||...:...::.|||:.     |...|.:...|.:|||.|:|.|.|..||...:
Mouse  2059 RGIPAPSLTWLKDGSPVSSFSNGIQILS-----GGRILALTSAQMSDAGRYTCVAVNAAGEKQRD 2118

  Fly  1212 AIATTVEDKNPFG------ALSGQIL------PAGEKPVFQWKRNGEEFDPEERFKVLFGEDEDS 1264
            .........|..|      .|.||.:      .|...|...|.::|..........:    .|:.
Mouse  2119 IDLRVYAPPNIMGEEQNVSVLIGQAVELFCQSDAVPPPTLMWLKDGRPLLKRPGLSI----SENG 2179

  Fly  1265 LALVFQHVKPEDAGIYTCVAQTSTG------NISCSAELSVQGAIQTLNREPEKPTLVIEHREAN 1323
            ..|..:..:..|.|.|||.|....|      |::.....|:.|:.:.:              :..
Mouse  2180 SVLKIEDAQAGDTGRYTCEATNVAGKTEKNYNVNVWVPPSIYGSDELV--------------QLT 2230

  Fly  1324 ASIGGSAILELQCKGFPKPAVQWKHDGEVIQVDDRHKFMYEDEESMSLVIKNVDTVDAGVYTIEA 1388
            |..|....|..:..|.|.|.:.||..|.::..|...: ::.......|.|...:..|||:||..|
Mouse  2231 AIEGNLITLLCESSGIPPPDLTWKKKGSLVLADSAGR-VHILSGGRRLQISIAEKADAGLYTCVA 2294

  Fly  1389 INELGQDESSINLVVKAPPKIKKI----TDITCSAGETIKMEIEVEGFPQPTVQVTNNGKDVTAE 1449
            .|..|..:...||.|...|.|...    .:||...|::|.:|.||:|.|||||....:|:.:|..
Mouse  2295 SNVAGVAKKEYNLQVYIRPSITNSGGHRPEITVIRGKSISLECEVQGIPQPTVTWMKDGRPLTKG 2359

  Fly  1450 SNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKATNDLSQTSEYWSCTVKSKPVIVKNFESEY 1514
            ..|:|..       |..::::|.:.:|..|.|...|.|....|.:.:..:|.:.|.|:.|     
Mouse  2360 KGVEILD-------EGRILQLKNVHVSDTGRYVCVAVNVAGMTDKRYDLSVHAPPSIIGN----- 2412

  Fly  1515 IHG--------EKENVQMTVRIDAYPEAKLTWYHDETEIKITDSKYTVS------------SDGN 1559
             ||        ||.:|.:|......|...:||..|...:.:..|...:|            .|..
Mouse  2413 -HGVPENVSVVEKSSVSLTCEASGIPLPSITWLKDGWPVNLGSSVKILSGGRMLRLMQTRPEDAG 2476

  Fly  1560 AYT-------------------------------------------------------------- 1562
            .||                                                              
Mouse  2477 QYTCIVRNAAGEDRKMFGLSVLVPPHIVGENTLEDVKIKEKQSVTLTCEVRGNPVPQITWHKDGQ 2541

  Fly  1563 ----------------LKITGATRVDAGKYTVKATNEHGSATSSTQLLIKCAPEFTHKLKNITVA 1611
                            |:||.|.....|:||..|:|..|..:.|.:|.:..:|         |:|
Mouse  2542 LLQEDEAHHMMSGGRFLQITNAQVSHTGRYTCLASNIAGDKSKSFRLNVFVSP---------TIA 2597

  Fly  1612 EGDSN-------------VELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQV 1663
            ..||:             ..||....:||.....|:.||..::..|| .|.:..|...: |:|..
Mouse  2598 GVDSDGSPEDVIVILNSPTSLVCEAYSYPPATITWFKDGTPLESNRN-IRILPGGRTLQ-ILNAQ 2660

  Fly  1664 ATNMQGNYTCKIMNDYGKLEDNCVVTVNCKPKVKRG--------LKNVEVQEGKSFTLEVEVYSE 1720
            ..| .|.|:|...|:.|:...:..|.|...|.:|:|        .|.|:::...|.|||.|.|:.
Mouse  2661 EDN-AGRYSCVATNEAGEKIKHYEVKVYIPPIIKKGDLLGPGLSPKEVKIRVNSSLTLECEAYAI 2724

  Fly  1721 PEAKIKWFKDGHEIYEDARIKISRDTQRIENYYLTLNLARTEDAGTYEMKATNFIGETTSTCKVA 1785
            |.|.::|:|||..:..|..:.|:     ...:.|.:..|:..|.|.|...|:|..||......|.
Mouse  2725 PSASLRWYKDGQPLKSDDHVTIA-----ASGHTLQIKEAQISDTGRYTCVASNLAGEDELDFDVN 2784

  Fly  1786 VLTSEALSLEQTVTKTLIATTEEPEEGAVPEIVHVDVFQQHSYESVPLKYEVIATGIPKPEAIWY 1850
            :....:......:...|    :....|...:::          .:.||.........|.|...||
Mouse  2785 IQVPPSFQKLWEIGNML----DTGRSGEAKDVI----------INNPLSLHCETNAAPPPTLTWY 2835

  Fly  1851 HDGKPITPDKHTAITVDGDHYKLEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSLSGIAEYRKPI 1915
            .||:|:|......|...|  ..|::....:.|||.|..|..|:.||.|.:.::.:      ..|.
Mouse  2836 KDGRPLTSSDRVLILPGG--RVLQIPRAKVEDAGRYTCVAVNEAGEDSLRYDVHV------LLPP 2892

  Fly  1916 LTQG-----PGLKDIKVNKGDKV-CEPVVFTADPAPEIVLLKDGQPVVETNNVKLKVDKKDAENG 1974
            :.:|     |....:.|||..:: |..   :.:|||.....||||.::|..:.|.:.|.:     
Mouse  2893 VIKGANSDLPEEVTVLVNKSTQMECSS---SGNPAPRNYWQKDGQILLEDEHHKFQSDGR----- 2949

  Fly  1975 LVQYTCTLNILEAEIKDSGRYELKVKN------KYGEL--------------------------- 2006
                  :|.||.|:|.|:|||....:|      ||..|                           
Mouse  2950 ------SLQILNAQITDTGRYVCVAENTAGSAKKYFNLNVHVPPSVIGPNHEHLSVVVNHFISLN 3008

  Fly  2007 -VTSG-------WI----------DVLAKP----------EISGLNDTKCL-------------- 2029
             ..||       |:          :||..|          :||...|..|:              
Mouse  3009 CEVSGFPPPDLSWLKNEEPIKPNTNVLTVPGGRTLQIIRAKISDGGDYTCIAINQAGESKKKVSL 3073

  Fly  2030 ----------------------PGDTICFEALVQANPKPKVSWTRGNENLCNHENCEVIADVDAD 2072
                                  .|.::..|....|.|.|.::|::....:.:..|.|::..... 
Mouse  3074 TVHVPPSIKDHGSQSLSIVNVREGTSVSLECESNAVPPPVITWSKNGRMIPDSTNVEILTGGQT- 3137

  Fly  2073 KYRLVFQSVSPCEDGKYTITATNSEGRAAVDFNLAVLVEKPTFIVQPESQSIHD--YRPVSTKVL 2135
               |..:.....:.|:|...|.|..||...:|:|.|.|  |..|..||::.|.:  ..||:....
Mouse  3138 ---LHIRRAEVSDTGQYVCRAINVAGRDDKNFHLNVYV--PPTIEGPETEVIVETISNPVTLTCD 3197

  Fly  2136 VHGVPLPTIEWFKDDKPINYEAINKPGKDKLYAKEDTKKGTDQIE-------SVLDIKSFRENDV 2193
            ..|:|.|||.|.|:.|||                    :.:|.:|       |.|.|...:.::.
Mouse  3198 ATGIPPPTITWLKNHKPI--------------------ENSDPLEVHILSGGSKLQIARPQRSNS 3242

  Fly  2194 GAYTCVATNEIGVTKAPFKLAMLSLAPSFV-KKLDNALDVLQGEPLVLECCVDGSPLPTVQWLKD 2257
            |.|||||:|..|..:..| :..:.:.||.. .::.:.:.||.||.:.|.|..||.|.|.:|||:|
Mouse  3243 GNYTCVASNMEGKAQKNF-ILFIQVPPSVAGAEVPSEVSVLLGENVELVCNADGIPTPHLQWLRD 3306

  Fly  2258 GDEVKPSESIKISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGE--KVALCAVAVKP-----EE 2315
            |..:...|:.::....||.. |.|.....:|.|.|..:.:||.||  ::....|.|.|     :|
Mouse  3307 GKPIVNGETERVRVTTDGST-LNIYRALTSDMGKYTCVATNPAGEEDRIFNLNVYVPPKIRGNKE 3370

  Fly  2316 MQPKFLKPITSQTVVVGEPLKLEAQVTGFPAPEVKWYKDGMLLRPSPEINFINSPNGQIGLIIDA 2380
            ...|.:       .:|...:.:|.:.||.|.|::.|.|:|:.|..|..|..:::  ||:..|: .
Mouse  3371 EAEKLM-------ALVDTSINIECKATGTPPPQINWLKNGLPLPISSHIRLLSA--GQVVRIV-R 3425

  Fly  2381 AQPLDAGVYKCLIANKGG-EIEGVSKVEIVPKESKPVFVAELQDASSIEGFPVKMDIKVVGNPKP 2444
            ||..|..||.|:.:|:.| :.:..|....||.........|  :.:.::|....|.....|.|.|
Mouse  3426 AQVSDIAVYTCVASNRAGVDSKHYSLQVFVPPNMDNAMGTE--EITIVKGSSTSMTCFTDGTPAP 3488

  Fly  2445 KLQWFHNGHEIKPDASHIAIVENPDNSSSLIIE--KTAPGDSGLYEVIAQNPEGSTASKAKLYVA 2507
            .:.|..:|..:.||| |:.:     ::..::::  |....|:|.|..:|.|..|..:....|.|.
Mouse  3489 SMSWLRDGQPLAPDA-HLTV-----STQGMVLQLIKAETEDTGKYTCVATNEAGEVSKHFVLKVL 3547

  Fly  2508 PKADETATEEAPQFVSALRDVNADEG---------QELVLSAPFISNPMPEVIWSKDGVTLTPNE 2563
                     |.|.       :|..||         ..|.||......|.|::.|.|||......|
Mouse  3548 ---------EPPH-------INGSEGPGEVSVIVNNPLELSCIASGIPAPKISWMKDGRPFLQTE 3596

  Fly  2564 RLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSSACNANVRKVYKPPVFTQKISDQQQVF 2628
            : :.|.:|..| |.:..|:..|:|.||||.::|.|:|.   ...:.:|:.||....  .|:.|.|
Mouse  3597 Q-VQTLEGGAI-LRVSSAQVEDTGRYTCLASSPAGDDD---KEYLVRVHVPPNIAG--MDEAQDF 3654

  Fly  2629 GNNAKIPVTV----SGVPYPDLEWYFQDKPIPKSEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIA 2689
            .......||:    ..||.|.:.|....:.:..:.:..|.:.|.:  |.:||.:.||...|.|:|
Mouse  3655 TVLRNRQVTLECKSDAVPPPVIMWLKNREQLQATPRVRILSGGRY--LQINNADLGDTANYTCVA 3717

  Fly  2690 SNREGKDITQGRLDIVNEIKKHSRSEPP-----------VFLKKIG-DCDIYEGMVAKFTACATG 2742
            ||..||...:..|.:         :.||           :..|.|. :|.            |.|
Mouse  3718 SNIAGKTTREFNLTV---------NVPPSIGGGPQSLVTLLNKSIALECR------------AEG 3761

  Fly  2743 YPEPEVEWFKNDQKLFPSD-RFLIDIEPNGLLRLTIKNVTEYDVGRYSCRIFNPYGDDICHAELF 2806
            .|.|.:.|.|:...|..|. |:  .|..||.|.:...:||  |.|||.|...|..|.|....:|.
Mouse  3762 VPAPRITWRKDGVVLAESHARY--SILENGFLHIESAHVT--DTGRYLCMATNVAGTDRRRIDLQ 3822

  Fly  2807 YDSLDS-------------QQKPLEDQYTDFKK----YKKSGAPPPLSEGPIISRMTDRGLLLSW 2854
            .....|             .|..|..:.|...|    ::|:|....:.:.....|:...|.|:..
Mouse  3823 VHVPPSIAMGPTNVTVTVNVQTTLACEATGIPKPSVTWRKNGHLLNVDQNQNSYRLLSSGSLVII 3887

  Fly  2855 NPSVPLTPRYPITYQIEMMDLPEGDWRT--LRTGVRSCACDIRNLEPFRDYRFRVRVENKFGVSD 2917
            :|||..|..|..|...:..:    |.|.  |...|.....|    ||.           .|.|:.
Mouse  3888 SPSVDDTASYECTVTSDAGE----DKRAVDLTVQVPPTIAD----EPM-----------DFLVTR 3933

  Fly  2918 PSPYTQTYRQKLVPDPPKTYT-----YLPPGTDFR---------PET-----------------S 2951
            .:|...|.....||.|...:|     .||.|..:|         |.|                 |
Mouse  3934 QAPAVMTCSASGVPVPSIHWTKNGLRLLPRGDGYRILSSGAIEIPTTQLNHAGRYTCVARNAAGS 3998

  Fly  2952 PYFPKDFDIERPPHDGLAQAPQFLLREQDISYGVKDHNTELM-WFVYGYPKPKMTYYFDDMLIES 3015
            .:......::.||          :::.|.....|..:|..|: ....|.|.|.:|:..:.:.:.:
Mouse  3999 AHRHVTLRVQEPP----------VIQPQPSELDVILNNPILLPCEATGIPTPFITWQKEGINVIT 4053

  Fly  3016 GGRFDQSYTRNGQATLFINKMLDRDVGWYEAVATNEHGEARQRVRLEIAEHPRFLKRPDETFIMA 3080
            .|:   |.......:|.|::.:..|.|.|..||.|..|.|..:|:|.:...|.......|..:..
Mouse  4054 SGK---SLAILPSGSLQISRAVRGDAGTYMCVAQNPAGTALGKVKLNVQVPPVISSHQKEYVVTM 4115

  Fly  3081 RKNGRIEAKLVGIPLPEVHWFKDWKPIVDSSR--------IKISSYDPDIYVLSIHDSIIKDGGL 3137
            .|...:..:..|.|.|::.|.||...:.:|.|        ::|:...||            |.|.
Mouse  4116 DKPVSLLCETEGSPPPDITWHKDGHALTESIRQRILNSGALQIAFAQPD------------DAGQ 4168

  Fly  3138 YSISARNIAG--SISTSVTVHIEENEDQYIYKTYGRHPYVRSKQLRYQDKYDIGDELGRGTQGIT 3200
            |:..|.|:||  |:|:::|||:.              |.::|.::.:....:....|.....||.
Mouse  4169 YTCMAANMAGSSSVSSTLTVHVP--------------PRIQSTEVHFTVNENSQAVLPCVADGIP 4219

  Fly  3201 YHAVERSSGDNYAAKIMYGRPELRPFMLNELEMMNTFNHKNLIRPYDAYDTDRSVTLIMELAAGG 3265
            ..|:.........|.::                     .|...:||                  |
Mouse  4220 TPAIHWEKDGVLIANLL---------------------GKYTAQPY------------------G 4245

  Fly  3266 ELVRDNLLRRDYYTERDIAHYIRQTLWGLEHMHEMGVGHMGLTIKDLLISVVGGDIIKVSDFGLS 3330
            ||:.:|::..|..|...:|:                             :..|.|...|:     
Mouse  4246 ELILENVVLEDSGTYTCVAN-----------------------------NAAGEDTRIVT----- 4276

  Fly  3331 RKINRHNLST---------LDYGMPEFVSPEVVNKEGVNFSHDMWTV--GLIT--YVLLGGHNPF 3382
              :..|.|.|         |:.|....:|.:.|   |:......||.  .:|.  :..:.||:..
Mouse  4277 --LAVHTLPTFTELPGDLSLNKGEQLRLSCKAV---GIPLPKLTWTFNNNIIPAHFDSINGHSEL 4336

  Fly  3383 LGIDDRETLTKIREGRWDFKDEIWTHI--SDDGRDFISRL-LLYSPEERMDVKTALKHPWFFMLD 3444
            :       :.|:.      |::..|::  :::...|:..: .:|           :|.|      
Mouse  4337 V-------IEKVS------KEDSGTYVCTAENSVGFVKAIGFVY-----------VKEP------ 4371

  Fly  3445 RPVYDHDYQIGTDRLRNYYDHFRDWYANASCKNYFRRRRLSGCFQHPSKMVYPPGHVYTPENTPE 3509
             ||:..||                                                   |.|..|
Mouse  4372 -PVFKGDY---------------------------------------------------PSNWIE 4384

  Fly  3510 PL-------------PEPRIRAKREEVVSKYLHPDYELGLIQSESHYQYGPDTYLLQLRDVNFPV 3561
            ||             |.|.|:..|:                        |.|             
Mouse  4385 PLGGNAILNCEVKGDPAPTIQWSRK------------------------GAD------------- 4412

  Fly  3562 RLREYMKVAHR----RSPSFALNDSVDWSLPVIRERRRFTDIMDEEIDDERTRSRISMYAANESY 3622
                 ::::||    .:.|.|:..:|                 :|:..|      .:..||||:.
Mouse  4413 -----IEISHRIRQLGNGSLAIYGTV-----------------NEDAGD------YTCVAANEAG 4449

  Fly  3623 SIRRLRTELGPRLDEYTEADAMIETQREGYPPFFREKPQTIAITENQPSHIHCFAVGDPKPCVQW 3687
            .:.|                :|..|.:..  |....:|....:.......:.|.|.|:|:|.:.|
Mouse  4450 MVER----------------SMSLTLQSS--PIITLEPVETVVDAGGRVILDCQAAGEPQPTITW 4496

  Fly  3688 FKNDMVLTESKRIKISVDEDGRSILRFEPALHFDVGVYKVVARNKVGQTVARCRIVVATLPDAPD 3752
            .:....::...|:.:..:    |.|....|...|...|:.||||.:|..:.|..::|        
Mouse  4497 SRQGQPISWDNRLSMLPN----SSLYIAAARKEDTSEYECVARNLMGSVLVRVPVIV-------- 4549

  Fly  3753 SPEISANSGTEILLRWKQPRDDGHSTVLC-YSLQYKLSNCD 3792
                ..:.|..:...|:.      .:|.| ..:|.:...||
Mouse  4550 ----QVHGGFSLWSAWRP------CSVTCGKGIQKRSRLCD 4580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ObscNP_001097440.1 RhoGEF 90..260 CDD:238091 8/43 (19%)
PH_unc89 275..388 CDD:270134 21/144 (15%)
Not5 <477..>652 CDD:444384 41/197 (21%)
Ig 1017..1108 CDD:472250 25/91 (27%)
Ig strand B 1034..1038 CDD:409353 0/3 (0%)
Ig strand C 1046..1050 CDD:409353 1/3 (33%)
Ig strand E 1074..1078 CDD:409353 1/4 (25%)
Ig strand F 1088..1093 CDD:409353 1/4 (25%)
Ig strand G 1101..1104 CDD:409353 0/2 (0%)
I-set 1123..1212 CDD:400151 26/88 (30%)
Ig strand B 1140..1144 CDD:409353 1/3 (33%)
Ig strand C 1153..1157 CDD:409353 0/3 (0%)
Ig strand E 1182..1186 CDD:409353 1/3 (33%)
Ig strand F 1196..1201 CDD:409353 2/4 (50%)
Ig strand G 1209..1212 CDD:409353 0/2 (0%)
Ig <1236..1299 CDD:472250 13/68 (19%)
Ig strand C 1238..1242 CDD:409353 0/3 (0%)
Ig strand E 1259..1269 CDD:409353 2/9 (22%)
Ig strand F 1279..1284 CDD:409353 3/4 (75%)
Ig strand G 1292..1295 CDD:409353 0/2 (0%)
I-set 1313..1403 CDD:400151 22/89 (25%)
Ig strand B 1330..1334 CDD:409353 1/3 (33%)
Ig strand C 1343..1347 CDD:409353 0/3 (0%)
Ig strand E 1369..1373 CDD:409353 1/3 (33%)
Ig strand F 1383..1388 CDD:409353 2/4 (50%)
Ig strand G 1396..1399 CDD:409353 0/2 (0%)
Ig_3 1406..1487 CDD:464046 25/84 (30%)
I-set 1499..1595 CDD:400151 31/193 (16%)
Ig strand B 1522..1526 CDD:409353 1/3 (33%)
Ig strand C 1535..1539 CDD:409353 1/3 (33%)
Ig strand E 1561..1565 CDD:409353 3/81 (4%)
Ig strand F 1575..1580 CDD:409353 2/4 (50%)
Ig strand G 1588..1591 CDD:409353 0/2 (0%)
Ig 1599..1690 CDD:472250 25/103 (24%)
Ig strand B 1617..1621 CDD:409353 1/3 (33%)
Ig strand C 1630..1634 CDD:409353 0/3 (0%)
Ig strand E 1656..1660 CDD:409353 0/3 (0%)
Ig strand F 1670..1675 CDD:409353 2/4 (50%)
Ig strand G 1683..1686 CDD:409353 0/2 (0%)
I-set 1694..1786 CDD:400151 29/99 (29%)
Ig strand B 1711..1715 CDD:409353 2/3 (67%)
Ig strand C 1724..1728 CDD:409353 0/3 (0%)
Ig strand E 1752..1756 CDD:409353 1/3 (33%)
Ig strand F 1766..1771 CDD:409353 1/4 (25%)
Ig strand G 1779..1782 CDD:409353 0/2 (0%)
Ig <1836..1903 CDD:472250 20/66 (30%)
Ig strand C 1846..1850 CDD:409353 0/3 (0%)
Ig strand E 1871..1875 CDD:409353 1/3 (33%)
Ig strand F 1885..1890 CDD:409353 1/4 (25%)
Ig 1922..2005 CDD:472250 26/89 (29%)
Ig strand B 1933..1937 CDD:409353 1/4 (25%)
Ig strand C 1946..1950 CDD:409353 0/3 (0%)
Ig strand E 1971..1984 CDD:409353 1/12 (8%)
Ig strand F 1994..1999 CDD:409353 2/4 (50%)
Ig 2018..2108 CDD:472250 22/135 (16%)
Ig strand B 2034..2038 CDD:409353 0/3 (0%)
Ig strand C 2047..2051 CDD:409353 0/3 (0%)
Ig strand E 2074..2078 CDD:409353 1/3 (33%)
Ig strand F 2088..2093 CDD:409353 1/4 (25%)
Ig strand G 2101..2104 CDD:409353 0/2 (0%)
Ig 2113..2214 CDD:472250 31/109 (28%)
Ig strand B 2130..2134 CDD:409353 1/3 (33%)
Ig strand C 2143..2147 CDD:409353 2/3 (67%)
Ig strand E 2176..2185 CDD:409353 4/15 (27%)
Ig strand F 2195..2200 CDD:409353 3/4 (75%)
I-set 2220..2302 CDD:400151 27/82 (33%)
Ig strand B 2238..2242 CDD:409353 1/3 (33%)
Ig strand C 2251..2255 CDD:409353 1/3 (33%)
Ig strand E 2277..2281 CDD:409353 1/3 (33%)
Ig strand F 2291..2296 CDD:409353 1/4 (25%)
Ig strand G 2304..2307 CDD:409353 0/2 (0%)
I-set 2318..2408 CDD:400151 25/90 (28%)
Ig strand B 2335..2339 CDD:409353 0/3 (0%)
Ig strand C 2348..2352 CDD:409353 0/3 (0%)
Ig strand E 2374..2378 CDD:409353 0/3 (0%)
Ig strand F 2388..2393 CDD:409353 3/4 (75%)
Ig 2415..2506 CDD:472250 20/92 (22%)
Ig strand B 2432..2436 CDD:409353 1/3 (33%)
Ig strand C 2445..2449 CDD:409353 0/3 (0%)
Ig strand E 2472..2476 CDD:409353 0/3 (0%)
Ig strand F 2486..2491 CDD:409353 1/4 (25%)
Ig strand G 2499..2502 CDD:409353 0/2 (0%)
I-set 2519..2608 CDD:400151 28/97 (29%)
Ig strand B 2536..2540 CDD:409353 2/3 (67%)
Ig strand C 2549..2553 CDD:409353 0/3 (0%)
Ig strand E 2574..2578 CDD:409353 2/3 (67%)
Ig strand F 2588..2593 CDD:409353 3/4 (75%)
I-set 2615..2696 CDD:400151 23/84 (27%)
Ig strand B 2632..2636 CDD:409353 0/3 (0%)
Ig strand C 2645..2649 CDD:409353 0/3 (0%)
Ig strand E 2670..2674 CDD:409353 1/3 (33%)
Ig strand F 2684..2689 CDD:409353 2/4 (50%)
Ig strand G 2697..2700 CDD:409353 0/2 (0%)
I-set 2717..2805 CDD:400151 27/100 (27%)
Ig strand B 2734..2738 CDD:409353 0/3 (0%)
Ig strand C 2747..2751 CDD:409353 0/3 (0%)
Ig strand E 2773..2777 CDD:409353 1/3 (33%)
Ig strand F 2787..2792 CDD:409353 3/4 (75%)
Ig strand G 2800..2803 CDD:409353 0/2 (0%)
FN3 2834..2925 CDD:238020 19/92 (21%)
Ig <2996..3063 CDD:472250 18/66 (27%)
Ig strand C 3003..3007 CDD:409353 1/3 (33%)
Ig strand E 3029..3033 CDD:409353 1/3 (33%)
Ig strand F 3043..3048 CDD:409353 1/4 (25%)
Ig strand G 3056..3059 CDD:409353 0/2 (0%)
Ig 3067..3157 CDD:472250 25/99 (25%)
Ig strand B 3085..3088 CDD:409353 0/2 (0%)
Ig strand C 3097..3101 CDD:409353 0/3 (0%)
Ig strand E 3123..3127 CDD:409353 0/3 (0%)
Ig strand F 3137..3142 CDD:409353 1/4 (25%)
Ig strand G 3150..3153 CDD:409353 1/2 (50%)
PK_Unc-89_rpt1 3182..3440 CDD:271011 38/273 (14%)
Ig 3654..3744 CDD:472250 20/89 (22%)
Ig strand B 3671..3675 CDD:409353 0/3 (0%)
Ig strand C 3684..3688 CDD:409353 0/3 (0%)
Ig strand E 3710..3714 CDD:409353 2/3 (67%)
Ig strand F 3724..3729 CDD:409353 1/4 (25%)
Ig strand G 3737..3740 CDD:409353 0/2 (0%)
FN3 3748..3840 CDD:238020 7/46 (15%)
STKc_Unc-89_rpt2 3893..4151 CDD:271014
Hmcn1XP_006529820.1 ChlD <30..210 CDD:440853
Ig 520..608 CDD:472250
Ig strand B 537..541 CDD:409544
Ig strand C 550..554 CDD:409544
Ig strand E 574..578 CDD:409544
Ig strand F 588..593 CDD:409544
Ig strand G 601..604 CDD:409544
Ig_3 611..685 CDD:464046
I-set 702..789 CDD:400151
Ig strand B 719..723 CDD:409405
Ig strand C 732..736 CDD:409405
Ig strand E 755..759 CDD:409405
Ig strand F 769..774 CDD:409405
Ig strand G 782..785 CDD:409405
Ig 793..884 CDD:472250
Ig strand B 810..814 CDD:409353
Ig strand C 823..829 CDD:409353
Ig strand E 850..854 CDD:409353
Ig strand F 864..869 CDD:409353
Ig strand G 877..880 CDD:409353
Ig 890..977 CDD:472250
Ig strand B 907..911 CDD:409389
Ig strand C 921..925 CDD:409389
Ig strand E 943..947 CDD:409389
Ig strand F 957..962 CDD:409389
Ig 980..1071 CDD:472250
Ig strand B 998..1002 CDD:409353
Ig strand C 1011..1015 CDD:409353
Ig strand E 1035..1038 CDD:409353
Ig strand F 1048..1053 CDD:409353
Ig strand G 1061..1064 CDD:409353
I-set 1085..1167 CDD:400151 6/38 (16%)
Ig strand B 1097..1101 CDD:409544
Ig strand C 1110..1114 CDD:409544
Ig strand E 1133..1137 CDD:409544 0/1 (0%)
Ig strand F 1147..1152 CDD:409544 0/8 (0%)
Ig strand G 1160..1163 CDD:409544 0/2 (0%)
I-set 1171..1257 CDD:400151 18/106 (17%)
Ig strand B 1188..1192 CDD:409353 1/3 (33%)
Ig strand C 1201..1205 CDD:409353 0/3 (0%)
Ig strand E 1223..1227 CDD:409353 0/3 (0%)
Ig strand F 1237..1242 CDD:409353 0/4 (0%)
Ig strand G 1250..1253 CDD:409353 1/2 (50%)
Ig 1261..1354 CDD:472250 16/97 (16%)
Ig strand B 1283..1287 CDD:409353 0/3 (0%)
Ig strand C 1296..1300 CDD:409353 0/3 (0%)
Ig strand E 1319..1323 CDD:409353 0/3 (0%)
Ig strand F 1334..1339 CDD:409353 0/4 (0%)
Ig strand G 1347..1350 CDD:409353 1/2 (50%)
I-set 1368..1447 CDD:400151 17/81 (21%)
Ig strand B 1377..1381 CDD:409353 1/3 (33%)
Ig strand C 1390..1394 CDD:409353 0/3 (0%)
Ig strand E 1413..1417 CDD:409353 0/3 (0%)
Ig strand F 1427..1432 CDD:409353 2/6 (33%)
IG_like 1459..1541 CDD:214653 15/85 (18%)
Ig strand B 1470..1474 CDD:409544 1/3 (33%)
Ig strand C 1483..1487 CDD:409544 1/3 (33%)
Ig strand E 1506..1511 CDD:409544 1/4 (25%)
Ig strand F 1521..1526 CDD:409544 0/4 (0%)
Ig strand G 1534..1537 CDD:409544 1/2 (50%)
Ig 1564..1632 CDD:472250 13/76 (17%)
Ig strand B 1564..1568 CDD:409353 0/4 (0%)
Ig strand C 1577..1581 CDD:409353 1/3 (33%)
Ig strand E 1600..1604 CDD:409353 1/3 (33%)
Ig strand F 1614..1619 CDD:409353 0/4 (0%)
I-set 1644..1728 CDD:400151 17/124 (14%)
Ig strand B 1658..1662 CDD:409389 1/7 (14%)
Ig strand C 1671..1675 CDD:409389 0/3 (0%)
Ig strand E 1693..1698 CDD:409389 1/4 (25%)
Ig strand F 1708..1713 CDD:409389 0/4 (0%)
I-set 1751..1821 CDD:400151 18/98 (18%)
Ig strand B 1752..1755 CDD:409353 0/2 (0%)
Ig strand C 1764..1768 CDD:409353 2/3 (67%)
Ig strand E 1786..1791 CDD:409353 1/13 (8%)
Ig strand F 1801..1806 CDD:409353 1/19 (5%)
Ig strand G 1814..1817 CDD:409353 0/2 (0%)
IG_like 1833..1938 CDD:214653 23/133 (17%)
Ig strand B 1843..1847 CDD:409353 1/11 (9%)
Ig strand C 1856..1860 CDD:409353 1/3 (33%)
Ig strand E 1886..1908 CDD:409353 5/21 (24%)
Ig strand F 1918..1923 CDD:409353 1/4 (25%)
Ig strand G 1931..1934 CDD:409353 0/2 (0%)
Ig 1952..2023 CDD:472250 23/85 (27%)
Ig strand B 1961..1965 CDD:409544 1/3 (33%)
Ig strand C 1974..1978 CDD:409544 1/3 (33%)
Ig strand E 1997..2001 CDD:409544 1/3 (33%)
Ig strand F 2011..2016 CDD:409544 1/4 (25%)
Ig 2044..2115 CDD:472250 23/75 (31%)
Ig strand B 2052..2056 CDD:409389 1/3 (33%)
Ig strand C 2065..2069 CDD:409389 0/3 (0%)
Ig strand E 2088..2093 CDD:409389 1/4 (25%)
Ig strand F 2103..2108 CDD:409389 2/4 (50%)
I-set 2134..2214 CDD:400151 17/83 (20%)
Ig strand B 2144..2148 CDD:409353 0/3 (0%)
Ig strand C 2157..2161 CDD:409353 0/3 (0%)
Ig strand E 2179..2184 CDD:409353 1/4 (25%)
Ig strand F 2194..2199 CDD:409353 3/4 (75%)
Ig strand G 2207..2210 CDD:409353 0/2 (0%)
I-set 2226..2309 CDD:400151 22/97 (23%)
Ig strand B 2237..2241 CDD:409405 1/3 (33%)
Ig strand C 2250..2254 CDD:409405 0/3 (0%)
Ig strand E 2276..2279 CDD:409405 1/2 (50%)
Ig strand F 2289..2294 CDD:409405 2/4 (50%)
Ig strand G 2304..2307 CDD:409405 0/2 (0%)
Ig_3 2312..2390 CDD:464046 25/84 (30%)
Ig strand B 2427..2431 CDD:409353 1/3 (33%)
Ig <2429..2497 CDD:472250 10/67 (15%)
Ig strand C 2440..2444 CDD:409353 1/3 (33%)
Ig strand E 2461..2467 CDD:409353 0/5 (0%)
Ig strand F 2477..2482 CDD:409353 2/4 (50%)
I-set 2501..2590 CDD:400151 12/88 (14%)
Ig strand B 2520..2524 CDD:409562 0/3 (0%)
Ig strand C 2533..2537 CDD:409562 0/3 (0%)
Ig strand E 2556..2560 CDD:409562 1/3 (33%)
Ig strand F 2570..2575 CDD:409562 2/4 (50%)
Ig strand G 2583..2586 CDD:409562 0/2 (0%)
I-set 2605..2686 CDD:400151 20/83 (24%)
Ig strand B 2617..2620 CDD:409353 1/2 (50%)
Ig strand C 2629..2633 CDD:409353 0/3 (0%)
Ig strand E 2652..2656 CDD:409353 0/4 (0%)
Ig strand F 2666..2671 CDD:409353 2/4 (50%)
I-set 2704..2785 CDD:400151 26/85 (31%)
Ig strand B 2715..2719 CDD:409544 2/3 (67%)
Ig strand C 2728..2732 CDD:409544 0/3 (0%)
Ig strand E 2750..2755 CDD:409544 1/4 (25%)
Ig strand F 2765..2770 CDD:409544 1/4 (25%)
I-set 2812..2881 CDD:400151 21/80 (26%)
Ig strand B 2818..2822 CDD:409353 1/3 (33%)
Ig strand C 2831..2835 CDD:409353 0/3 (0%)
Ig strand E 2854..2858 CDD:409353 1/3 (33%)
Ig strand F 2868..2873 CDD:409353 1/4 (25%)
I-set 2902..2983 CDD:400151 28/94 (30%)
Ig strand B 2913..2917 CDD:409544 0/3 (0%)
Ig strand C 2926..2930 CDD:409544 0/3 (0%)
Ig strand E 2948..2953 CDD:409544 1/15 (7%)
Ig strand F 2963..2968 CDD:409544 2/4 (50%)
I-set 3005..3075 CDD:400151 10/69 (14%)
Ig strand B 3005..3009 CDD:409353 0/3 (0%)
Ig strand C 3018..3022 CDD:409353 0/3 (0%)
Ig strand E 3041..3045 CDD:409353 0/3 (0%)
Ig strand F 3055..3060 CDD:409353 2/4 (50%)
Ig strand G 3068..3071 CDD:409353 0/2 (0%)
I-set 3087..3170 CDD:400151 17/86 (20%)
Ig strand B 3100..3104 CDD:409562 0/3 (0%)
Ig strand C 3113..3117 CDD:409562 0/3 (0%)
Ig strand E 3136..3140 CDD:409562 1/7 (14%)
Ig strand F 3150..3155 CDD:409562 1/4 (25%)
Ig strand G 3163..3166 CDD:409562 0/2 (0%)
Ig_3 3173..3251 CDD:464046 28/97 (29%)
Ig 3267..3361 CDD:472250 30/94 (32%)
Ig strand B 3287..3291 CDD:409353 1/3 (33%)
Ig strand C 3300..3304 CDD:409353 1/3 (33%)
Ig strand E 3325..3329 CDD:409353 1/4 (25%)
Ig strand F 3339..3344 CDD:409353 1/4 (25%)
Ig strand G 3352..3355 CDD:409353 0/2 (0%)
I-set 3377..3453 CDD:400151 24/78 (31%)
Ig strand B 3383..3387 CDD:409562 0/3 (0%)
Ig strand C 3396..3400 CDD:409562 0/3 (0%)
Ig strand E 3419..3423 CDD:409562 1/3 (33%)
Ig strand F 3433..3438 CDD:409562 3/4 (75%)
Ig strand G 3446..3449 CDD:409562 0/2 (0%)
I-set 3468..3546 CDD:400151 19/83 (23%)
Ig strand B 3476..3480 CDD:409544 1/3 (33%)
Ig strand C 3489..3493 CDD:409544 0/3 (0%)
Ig strand E 3511..3516 CDD:409544 0/4 (0%)
Ig strand F 3526..3531 CDD:409544 1/4 (25%)
Ig strand G 3539..3542 CDD:409544 0/2 (0%)
Ig 3556..3629 CDD:472250 24/74 (32%)
Ig strand B 3569..3573 CDD:409544 2/3 (67%)
Ig strand C 3582..3586 CDD:409544 0/3 (0%)
Ig strand E 3604..3609 CDD:409544 2/5 (40%)
Ig strand F 3619..3624 CDD:409544 3/4 (75%)
I-set 3652..3732 CDD:400151 23/81 (28%)
Ig strand B 3662..3666 CDD:409353 2/3 (67%)
Ig strand C 3675..3679 CDD:409353 0/3 (0%)
Ig strand E 3698..3702 CDD:409353 1/5 (20%)
Ig strand F 3712..3717 CDD:409353 2/4 (50%)
I-set 3736..3823 CDD:400151 28/102 (27%)
Ig strand B 3753..3757 CDD:409544 1/3 (33%)
Ig strand C 3766..3770 CDD:409544 0/3 (0%)
Ig strand E 3789..3793 CDD:409544 2/3 (67%)
Ig strand F 3803..3808 CDD:409544 3/4 (75%)
Ig 3846..3907 CDD:409353 14/60 (23%)
Ig strand C 3857..3861 CDD:409353 0/3 (0%)
Ig strand E 3882..3886 CDD:409353 2/3 (67%)
Ig strand F 3896..3901 CDD:409353 1/4 (25%)
Ig 3922..4007 CDD:472250 18/99 (18%)
Ig strand B 3937..3941 CDD:409544 0/3 (0%)
Ig strand C 3950..3954 CDD:409544 0/3 (0%)
Ig strand E 3973..3977 CDD:409544 0/3 (0%)
Ig strand F 3987..3992 CDD:409544 0/4 (0%)
Ig strand G 4000..4003 CDD:409544 0/2 (0%)
Ig_3 4010..4085 CDD:464046 19/87 (22%)
Ig_3 4101..4175 CDD:464046 18/85 (21%)
Ig_3 4191..4266 CDD:464046 17/156 (11%)
I-set 4283..4368 CDD:400151 16/111 (14%)
Ig strand B 4300..4304 CDD:409405 0/3 (0%)
Ig strand C 4313..4317 CDD:409405 0/3 (0%)
Ig strand E 4334..4338 CDD:409405 0/10 (0%)
Ig strand F 4348..4353 CDD:409405 1/4 (25%)
Ig 4379..4458 CDD:472250 24/159 (15%)
Ig strand B 4390..4394 CDD:409390 0/3 (0%)
Ig strand C 4403..4407 CDD:409390 1/3 (33%)
Ig strand E 4425..4429 CDD:409390 1/3 (33%)
Ig strand F 4439..4444 CDD:409390 1/10 (10%)
Ig strand G 4452..4455 CDD:409390 1/18 (6%)
Ig 4464..4549 CDD:472250 19/88 (22%)
Ig strand B 4480..4484 CDD:409544 0/3 (0%)
Ig strand C 4493..4497 CDD:409544 0/3 (0%)
Ig strand E 4515..4519 CDD:409544 2/3 (67%)
Ig strand F 4529..4534 CDD:409544 1/4 (25%)
Ig strand G 4542..4545 CDD:409544 0/2 (0%)
TSP1 4556..4607 CDD:214559 6/31 (19%)
TSP1 4612..4664 CDD:214559
TSP1 4669..4721 CDD:214559
TSP1 4726..4778 CDD:214559
TSP1 4783..4835 CDD:214559
TSP1 4840..4892 CDD:214559
G2F 4891..5115 CDD:214774
EGF_CA 5130..5169 CDD:214542
EGF_CA 5170..5197 CDD:429571
EGF_CA 5215..5252 CDD:214542
EGF_CA 5253..5286 CDD:238011
EGF_CA 5295..5326 CDD:429571
EGF_CA 5338..5377 CDD:214542
EGF_CA 5455..5494 CDD:214542
EGF_CA 5495..5531 CDD:214542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.