DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obsc and NCAM1

DIOPT Version :10

Sequence 1:NP_001097440.1 Gene:Obsc / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:NP_001387553.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:1129 Species:Homo sapiens


Alignment Length:1526 Identity:299/1526 - (19%)
Similarity:488/1526 - (31%) Gaps:526/1526 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  1100 TTVSAQLAVGQAPGHDETKTNTEPAFLVSLKDAEMIENTLFRFMVKIIGDPKPR-VKFYKDEKEI 1163
            |.||.|:.:..:.|.            :|:.:::.       |:.::.||.|.: :.::....|.
Human    16 TAVSLQVDIVPSQGE------------ISVGESKF-------FLCQVAGDAKDKDISWFSPNGEK 61

  Fly  1164 LETN-DRIQIIRDKDYLGFYELVIADVQKTDAGTYSCKATNKHGEANCEAIATTVEDKNPF-GAL 1226
            |..| .||.::.:.|  ....|.|.:....|||.|.|..|.:.|..:...:...:..|..| .|.
Human    62 LTPNQQRISVVWNDD--SSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAP 124

  Fly  1227 SGQILPAGE------------KPVFQWKRNGEE--FDPEERFKVLFGEDEDSLALVFQHVKPEDA 1277
            :.|....||            .|...||..|.:  ...:.||.||     .:..|..:.:|..|.
Human   125 TPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVL-----SNNYLQIRGIKKTDE 184

  Fly  1278 GIYTCVAQTSTGNISCSAELSVQGAIQTLNREPEKPTLVIEHRE----ANASIGGSAILELQCKG 1338
            |.|.|     .|.|....|::.:. ||.:...|  ||  |:.|:    |.|::|.|..|....:|
Human   185 GTYRC-----EGRILARGEINFKD-IQVIVNVP--PT--IQARQNIVNATANLGQSVTLVCDAEG 239

  Fly  1339 FPKPAVQWKHDGEVI-QVDDRHKFMYEDEESMSLVIKNVDTVDAGVYTIEAINELGQDESSINLV 1402
            ||:|.:.|..|||.| |.:|..|:::.|:.| .|.||.||..|...|...|.|:.|:.:::|:|.
Human   240 FPEPTMSWTKDGEQIEQEEDDEKYIFSDDSS-QLTIKKVDKNDEAEYICIAENKAGEQDATIHLK 303

  Fly  1403 VKAPPKIKKITDITC-SAGETIKMEIEVEGFPQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKV 1466
            |.|.|||..:.:.|. ...|.:.:..|..|.|.|::....:.:::::|.....:.....::|:..
Human   304 VFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQETLDGH 368

  Fly  1467 VV----------EVKEIKLSQAGNYSIKATNDLSQTSEYWSCTVK-----SKPVIVKNFESEYIH 1516
            :|          .:|.|:.:.||.|...|:|.:.|.|:.....|:     ..||.|..:|.    
Human   369 MVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEG---- 429

  Fly  1517 GEKENVQMTVRIDAYPEAKLTWYHDETEIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKAT 1581
               ..|.:|..:.|||.|.::|:.|                                        
Human   430 ---NQVNITCEVFAYPSATISWFRD---------------------------------------- 451

  Fly  1582 NEHGSATSSTQLLIKCAPEFTHKLKNITVAEGDSNVELVVGVDAYPRPHAKWYIDGIEI-DEKRN 1645
                     .|||    |...:           ||:::      |..|.|.:    :|: .:..|
Human   452 ---------GQLL----PSSNY-----------SNIKI------YNTPSASY----LEVTPDSEN 482

  Fly  1646 DFRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDYGKLEDNCVVTVNCKPKVKRGLKNVEVQEGKS 1710
            ||                     |||.|..:|..|:.....::.....|    ...:::..|..|
Human   483 DF---------------------GNYNCTAVNRIGQESLEFILVQADTP----SSPSIDQVEPYS 522

  Fly  1711 FTLEVEVYSEPEA---------KIKWFKDGHEIYEDARIKISRDTQRIENYYLTLNLARTEDAGT 1766
            .|.:|: :.||||         |.:|...|.|::.             ..:|         ||..
Human   523 STAQVQ-FDEPEATGGVPILKYKAEWRAVGEEVWH-------------SKWY---------DAKE 564

  Fly  1767 YEMKA-TNFIG---ETTSTCKVAVLTSEALSLEQTVTKTLIATTEEPE----EGAVPE---IVHV 1820
            ..|:. ...:|   |||...::|.|..:.|......::.......||.    ||.:.|   .:.|
Human   565 ASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVREPSAPKLEGQMGEDGNSIKV 629

  Fly  1821 DVFQQHSYESVPLKYEVIATGIPKPEAIWYHDGKPITPDKHTAITVDGDHYKLEVQSLDLVDAGE 1885
            ::.:|..                        .|.||.            ||.:..::|    :.|
Human   630 NLIKQDD------------------------GGSPIR------------HYLVRYRAL----SSE 654

  Fly  1886 YKVVVQNKVGEKSHQGELSLSGIAEYRKPILTQGPGLKDIKVNKGDKVCEPVVF------TADPA 1944
            :|..::...| ..|....||...|||...::.:.        .:|.......||      ||.||
Human   655 WKPEIRLPSG-SDHVMLKSLDWNAEYEVYVVAEN--------QQGKSKAAHFVFRTSAQPTAIPA 710

  Fly  1945 PEIVLLKDGQPVVETNNVKLKVDKKDAENGLVQYTCTLNILEAEIKDSGRYELKVKNKYGELVTS 2009
                   :|.|   |:.:        :...:|.....:.:|...:.|...|.|   ||.|..:  
Human   711 -------NGSP---TSGL--------STGAIVGILIVIFVLLLVVVDITCYFL---NKCGLFM-- 752

  Fly  2010 GWIDVLAKPEISGLNDTKCLPGDTICFEALVQANPKPKVSWTRGNENLCNHENCEVIADVDADKY 2074
                              |: ...:|.:|...|..|   ....|.......|:.|.|.:|..::.
Human   753 ------------------CI-AVNLCGKAGPGAKGK---DMEEGKAAFSKDESKEPIVEVRTEEE 795

  Fly  2075 RLVFQSVSPCED-GKYTITATNSEGRAAVDFNLAVLVEKPTFIVQPESQSIHDYRPVSTKVLVHG 2138
            |      :|..| ||:|..                  .:.|.:.:||       .|..|...|..
Human   796 R------TPNHDGGKHTEP------------------NETTPLTEPE-------LPADTTATVED 829

  Fly  2139 VPLPTIEWFKDDKPINYEAINKPGKDKLYAKEDTKKGTDQIESVLDIKSFRENDVGAYTCVATNE 2203
            : ||::...                            |...:::.:..:..:|...:.|...|:.
Human   830 M-LPSVTTV----------------------------TTNSDTITETFATAQNSPTSETTTLTSS 865

  Fly  2204 IGVTKAPFKLAMLSLAPSFVKKLDNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIK 2268
            |    ||         |:......|::...|..|.........||.|.     ...:|.|  .:.
Human   866 I----AP---------PATATPDSNSVPAGQATPSKGPSASAPSPAPA-----SAPKVAP--LVD 910

  Fly  2269 ISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKFLKPITSQTVVVGE 2333
            :|..|         :..|..|.....:::|                  |...|.|  |....|||
Human   911 LSDTP---------TSTPAASNLSSSVLAN------------------QGAVLSP--SAPAGVGE 946

  Fly  2334 PLKLEAQVTGFPAPEVKWYKDGMLLRPSPEINFINSPNGQIGLIIDAAQPLDAGVYKCLIA---- 2394
            ..|........|||                   :.:|.|       ||.||.|.......|    
Human   947 ASKAPPASKPTPAP-------------------VPTPTG-------AASPLAAAAAPATEAPQAK 985

  Fly  2395 -----NKGGEIE----GVSKVEIVPKESKPVFVAELQDASSI------EGFPVKMD--------- 2435
                 .||.:.|    |.:|   .|.|:.....:...:|:|:      :|...|||         
Human   986 QEAPSTKGPDPEPTQPGAAK---SPAEAATALASPKSEAASVSTTNPSQGEDFKMDEGNFKTPDI 1047

  Fly  2436 ------IKVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNP 2494
                  ...:|:|.|.........|:.|..:                      ||.:....|:..
Human  1048 DLAKDVFAALGSPAPAAGASGQAPELAPSTA----------------------DSSVSPAPAKTE 1090

  Fly  2495 EGSTASKAKLYVAPKADETATEEAPQFVSAL 2525
            :|...:|      |:..||.|:.||..|..:
Human  1091 KGPVEAK------PECQETETKPAPAEVKTV 1115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ObscNP_001097440.1 RhoGEF 90..260 CDD:238091
PH_unc89 275..388 CDD:270134
Not5 <477..>652 CDD:444384
Ig 1017..1108 CDD:472250 4/7 (57%)
Ig strand B 1034..1038 CDD:409353
Ig strand C 1046..1050 CDD:409353
Ig strand E 1074..1078 CDD:409353
Ig strand F 1088..1093 CDD:409353
Ig strand G 1101..1104 CDD:409353 1/2 (50%)
I-set 1123..1212 CDD:400151 20/90 (22%)
Ig strand B 1140..1144 CDD:409353 1/3 (33%)
Ig strand C 1153..1157 CDD:409353 0/4 (0%)
Ig strand E 1182..1186 CDD:409353 1/3 (33%)
Ig strand F 1196..1201 CDD:409353 2/4 (50%)
Ig strand G 1209..1212 CDD:409353 0/2 (0%)
Ig <1236..1299 CDD:472250 17/64 (27%)
Ig strand C 1238..1242 CDD:409353 0/3 (0%)
Ig strand E 1259..1269 CDD:409353 1/9 (11%)
Ig strand F 1279..1284 CDD:409353 2/4 (50%)
Ig strand G 1292..1295 CDD:409353 0/2 (0%)
I-set 1313..1403 CDD:400151 35/94 (37%)
Ig strand B 1330..1334 CDD:409353 1/3 (33%)
Ig strand C 1343..1347 CDD:409353 0/3 (0%)
Ig strand E 1369..1373 CDD:409353 1/3 (33%)
Ig strand F 1383..1388 CDD:409353 1/4 (25%)
Ig strand G 1396..1399 CDD:409353 0/2 (0%)
Ig_3 1406..1487 CDD:464046 18/91 (20%)
I-set 1499..1595 CDD:400151 15/100 (15%)
Ig strand B 1522..1526 CDD:409353 1/3 (33%)
Ig strand C 1535..1539 CDD:409353 0/3 (0%)
Ig strand E 1561..1565 CDD:409353 0/3 (0%)
Ig strand F 1575..1580 CDD:409353 0/4 (0%)
Ig strand G 1588..1591 CDD:409353 0/2 (0%)
Ig 1599..1690 CDD:472250 16/91 (18%)
Ig strand B 1617..1621 CDD:409353 0/3 (0%)
Ig strand C 1630..1634 CDD:409353 1/3 (33%)
Ig strand E 1656..1660 CDD:409353 0/3 (0%)
Ig strand F 1670..1675 CDD:409353 3/4 (75%)
Ig strand G 1683..1686 CDD:409353 0/2 (0%)
I-set 1694..1786 CDD:400151 21/104 (20%)
Ig strand B 1711..1715 CDD:409353 1/3 (33%)
Ig strand C 1724..1728 CDD:409353 1/3 (33%)
Ig strand E 1752..1756 CDD:409353 1/3 (33%)
Ig strand F 1766..1771 CDD:409353 1/4 (25%)
Ig strand G 1779..1782 CDD:409353 1/2 (50%)
Ig <1836..1903 CDD:472250 10/66 (15%)
Ig strand C 1846..1850 CDD:409353 0/3 (0%)
Ig strand E 1871..1875 CDD:409353 1/3 (33%)
Ig strand F 1885..1890 CDD:409353 2/4 (50%)
Ig 1922..2005 CDD:472250 17/88 (19%)
Ig strand B 1933..1937 CDD:409353 0/3 (0%)
Ig strand C 1946..1950 CDD:409353 0/3 (0%)
Ig strand E 1971..1984 CDD:409353 1/12 (8%)
Ig strand F 1994..1999 CDD:409353 2/4 (50%)
Ig 2018..2108 CDD:472250 16/90 (18%)
Ig strand B 2034..2038 CDD:409353 1/3 (33%)
Ig strand C 2047..2051 CDD:409353 0/3 (0%)
Ig strand E 2074..2078 CDD:409353 1/3 (33%)
Ig strand F 2088..2093 CDD:409353 2/4 (50%)
Ig strand G 2101..2104 CDD:409353 0/2 (0%)
Ig 2113..2214 CDD:472250 15/100 (15%)
Ig strand B 2130..2134 CDD:409353 1/3 (33%)
Ig strand C 2143..2147 CDD:409353 0/3 (0%)
Ig strand E 2176..2185 CDD:409353 1/8 (13%)
Ig strand F 2195..2200 CDD:409353 1/4 (25%)
I-set 2220..2302 CDD:400151 14/81 (17%)
Ig strand B 2238..2242 CDD:409353 0/3 (0%)
Ig strand C 2251..2255 CDD:409353 0/3 (0%)
Ig strand E 2277..2281 CDD:409353 0/3 (0%)
Ig strand F 2291..2296 CDD:409353 0/4 (0%)
Ig strand G 2304..2307 CDD:409353 0/2 (0%)
I-set 2318..2408 CDD:400151 23/102 (23%)
Ig strand B 2335..2339 CDD:409353 1/3 (33%)
Ig strand C 2348..2352 CDD:409353 0/3 (0%)
Ig strand E 2374..2378 CDD:409353 0/3 (0%)
Ig strand F 2388..2393 CDD:409353 0/4 (0%)
Ig 2415..2506 CDD:472250 16/111 (14%)
Ig strand B 2432..2436 CDD:409353 3/18 (17%)
Ig strand C 2445..2449 CDD:409353 0/3 (0%)
Ig strand E 2472..2476 CDD:409353 0/3 (0%)
Ig strand F 2486..2491 CDD:409353 0/4 (0%)
Ig strand G 2499..2502 CDD:409353 0/2 (0%)
I-set 2519..2608 CDD:400151 2/7 (29%)
Ig strand B 2536..2540 CDD:409353
Ig strand C 2549..2553 CDD:409353
Ig strand E 2574..2578 CDD:409353
Ig strand F 2588..2593 CDD:409353
I-set 2615..2696 CDD:400151
Ig strand B 2632..2636 CDD:409353
Ig strand C 2645..2649 CDD:409353
Ig strand E 2670..2674 CDD:409353
Ig strand F 2684..2689 CDD:409353
Ig strand G 2697..2700 CDD:409353
I-set 2717..2805 CDD:400151
Ig strand B 2734..2738 CDD:409353
Ig strand C 2747..2751 CDD:409353
Ig strand E 2773..2777 CDD:409353
Ig strand F 2787..2792 CDD:409353
Ig strand G 2800..2803 CDD:409353
FN3 2834..2925 CDD:238020
Ig <2996..3063 CDD:472250
Ig strand C 3003..3007 CDD:409353
Ig strand E 3029..3033 CDD:409353
Ig strand F 3043..3048 CDD:409353
Ig strand G 3056..3059 CDD:409353
Ig 3067..3157 CDD:472250
Ig strand B 3085..3088 CDD:409353
Ig strand C 3097..3101 CDD:409353
Ig strand E 3123..3127 CDD:409353
Ig strand F 3137..3142 CDD:409353
Ig strand G 3150..3153 CDD:409353
PK_Unc-89_rpt1 3182..3440 CDD:271011
Ig 3654..3744 CDD:472250
Ig strand B 3671..3675 CDD:409353
Ig strand C 3684..3688 CDD:409353
Ig strand E 3710..3714 CDD:409353
Ig strand F 3724..3729 CDD:409353
Ig strand G 3737..3740 CDD:409353
FN3 3748..3840 CDD:238020
STKc_Unc-89_rpt2 3893..4151 CDD:271014
NCAM1NP_001387553.1 IgI_1_NCAM-1 20..116 CDD:409451 22/116 (19%)
Ig strand A 20..25 CDD:409451 1/4 (25%)
Ig strand A' 28..32 CDD:409451 1/15 (7%)
Ig strand B 34..44 CDD:409451 1/16 (6%)
Ig strand C 50..56 CDD:409451 0/5 (0%)
Ig strand C' 59..61 CDD:409451 0/1 (0%)
Ig strand D 69..75 CDD:409451 1/5 (20%)
Ig strand E 77..85 CDD:409451 2/7 (29%)
Ig strand F 92..100 CDD:409451 3/7 (43%)
Ig strand G 104..115 CDD:409451 0/10 (0%)
IG_like 124..190 CDD:214653 17/75 (23%)
Ig strand B 135..139 CDD:409353 0/3 (0%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 172..176 CDD:409353 1/3 (33%)
Ig 211..307 CDD:472250 37/100 (37%)
Ig strand B 231..235 CDD:409353 1/3 (33%)
Ig strand C 244..248 CDD:409353 0/3 (0%)
Ig strand E 270..274 CDD:409353 2/4 (50%)
Ig strand F 284..289 CDD:409353 1/4 (25%)
Ig strand G 297..300 CDD:409353 0/2 (0%)
IgI_NCAM-1 306..412 CDD:143277 22/105 (21%)
Ig strand A 306..311 CDD:143277 3/4 (75%)
Ig strand A' 315..319 CDD:143277 1/3 (33%)
Ig strand B 324..332 CDD:143277 1/7 (14%)
Ig strand C 338..344 CDD:143277 0/5 (0%)
Ig strand C' 347..350 CDD:143277 0/2 (0%)
Ig strand D 368..374 CDD:143277 1/5 (20%)
Ig strand E 377..383 CDD:143277 0/5 (0%)
Ig strand F 391..399 CDD:143277 3/7 (43%)
Ig strand G 402..412 CDD:143277 2/9 (22%)
IG_like 421..499 CDD:214653 31/179 (17%)
Ig strand B 432..436 CDD:409353 1/3 (33%)
Ig strand C 445..449 CDD:409353 0/3 (0%)
Ig strand E 472..476 CDD:409353 0/7 (0%)
Ig strand F 486..491 CDD:409353 3/4 (75%)
fn3 511..598 CDD:394996 23/109 (21%)
fn3 612..693 CDD:394996 21/129 (16%)
PRK12323 <913..1108 CDD:481241 50/280 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.