DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obsc and Obscn

DIOPT Version :10

Sequence 1:NP_001097440.1 Gene:Obsc / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:NP_001415297.1 Gene:Obscn / 380698 MGIID:2681862 Length:8877 Species:Mus musculus


Alignment Length:4616 Identity:862/4616 - (18%)
Similarity:1413/4616 - (30%) Gaps:1723/4616 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   961 EARSSLLATGRTESRAASRAESRAESRA-----SYSVAESRA---------------------GI 999
            ||....:||.|.:...|:..|.|..|:.     .||:.:..|                     |.
Mouse  4568 EATEGTMATLRCQMSKAAPVEWRKGSKTLRDGDRYSLRQDGAMCELQICDLAVEDTGDYSCVCGQ 4632

  Fly  1000 RSSSRLQEDRPLRSVDKPVVVKMLKSVQVEPGETAHFEIQF-KDQPGLVTWLKDNKPLEDRLADR 1063
            ..:|.....:.|    .|..::.|:|.:...|..|....:. |..|  |.|.|.::.|:|  .||
Mouse  4633 EKTSATLSVKAL----PPRFIEDLRSQEAREGTVATLRCRMSKAAP--VEWRKGSETLKD--GDR 4689

  Fly  1064 --ITQTAAPMNSYRLDIKNCSETDAGTYTIRAQSASETTTVSAQLAVGQAPGHDETKTNTEPAFL 1126
              :.|..   |...|.|::.:..|...|:  .....|.|  ||.|:|...|.          .|:
Mouse  4690 YSLRQEG---NLCELQIRDLAVEDTEEYS--CVCGQEKT--SATLSVKALPA----------KFI 4737

  Fly  1127 VSLKDAEMIENTLFRFMVKIIGDPKPRVKFYKDEKEILETNDRIQIIRDKDYLGFYELVIADVQK 1191
            ..|:..|..|::......|:   .|.....:|...|.|....|..:.:|.   ...||.|.|:..
Mouse  4738 EDLRSQEAPESSTVTLRCKL---SKKASVVWKKGSETLRNGARYSLRQDG---AVCELEIRDLTV 4796

  Fly  1192 TDAGTYSCKATNKHGEANCEAIATTVEDKNPFGALSGQILPAGE-------------KPVFQWKR 1243
            .|.|.|||....:...|....:|..|..:.|.     |.|.|.|             .....|.:
Mouse  4797 EDTGEYSCTCGQERTSATLSIMAPQVVFQQPL-----QNLQAEEGSMASLRCELSVPNAAMVWSK 4856

  Fly  1244 NGEEFDPEERFKVLFGEDEDSLA-LVFQHVKPEDAGIY--TCVAQTSTGNISCSA-------ELS 1298
            .|.|...:.|.:   ...:..:| |:.:.::.||||.|  ||.:||::..:..:|       ||.
Mouse  4857 GGLELQGDTRRE---ARQQGCVAELLLRDLRREDAGEYSCTCGSQTTSATLMVTAAPVRFLRELQ 4918

  Fly  1299 VQ----GAIQTLNREPEKPTLVIEHREANASIGGSAILELQCKGFPKPAVQWKHDGEVIQVDDRH 1359
            .|    ||...|..|..:..:.:|.|:.:..:            ||....|              
Mouse  4919 AQDVDEGATARLRCELSREAVSVEWRKGSLQL------------FPCAKYQ-------------- 4957

  Fly  1360 KFMYEDEESMSLVIKNVDTVDAGVYTIEAINELGQDESSINLVVKAP-PKIKKITDITCS---AG 1420
              |.::..:..|::..|:..|||.||.:|    |..:|...|.|:|| ||.|  ||:..:   ||
Mouse  4958 --MVQEGTTAELLVHGVEQEDAGEYTCDA----GHTQSIARLSVRAPKPKFK--TDLQSTEQEAG 5014

  Fly  1421 ETIKMEIEV-EGFPQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVV--VEVKEIKLSQAGNYS 1482
            .|.::..:: |..|...||....|.::...|..::...  |...|.::  :|.|:          
Mouse  5015 GTARLCCQLSEAEPGTPVQWLKEGVELHVGSKYEMRRQ--GAVCELLIHGLEAKD---------- 5067

  Fly  1483 IKATNDLSQTSEYWSCTVKSKPVI----VKNFESEYIHG-------EKENVQMTVRIDAYPEAKL 1536
                     |.|| :|.|..:..:    ||..|...:.|       ..|:|:.|.::.......:
Mouse  5068 ---------TGEY-ACLVGGQKTLASLRVKEPEVTIVRGLVDMEVQADEDVEFTCKVSQAGATDV 5122

  Fly  1537 TWY--------HDETEIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQL 1593
            .|:        ::.||:       .|.:||..:.|::.|.|..|||..:...    |..:||.||
Mouse  5123 QWHLQGLPLQSNEVTEV-------AVLADGCTHVLQLKGVTLEDAGTVSFHV----GGLSSSAQL 5176

  Fly  1594 LIKCAPEFTHKLKNITVAEGDSNVELVVGVDAYPR--------PHAKWYIDGIEID-EKRNDFRH 1649
            .:: .||       :||.|...:|:|..|.||:.|        ..|:|.:.|:.:. .:.||.. 
Mouse  5177 TVR-VPE-------VTVLEPLKDVQLSEGQDAHFRCRLSRASGQEARWALGGVPLQCNEMNDIT- 5232

  Fly  1650 VEEGNDFKLIMNQVATNMQGNYTCKIMNDYGKLEDNCVVTVNCKPKVKRGLKNVEVQEGKSFTLE 1714
            ||:|..:.|.:::|.....|..|.::    |.......:.|..|..|.|||:||:..||.....|
Mouse  5233 VEQGTLYLLTLHKVTLEDAGTITLQV----GSCSSEAQLKVTAKNTVLRGLENVDALEGGEALFE 5293

  Fly  1715 VEVYSEPE-AKIKWFKDGHEIYEDARIKI-----------------SRDTQR--------IENYY 1753
            .:: |:|| |...|..|...::...::::                 .:|:.|        :.:.:
Mouse  5294 CQL-SQPEVAAHTWLLDDEPVHTSEKVEVVYFENGLRHLLLLKNLKPQDSCRVTFLAGDVVTSAF 5357

  Fly  1754 LTLNLARTE------DAGTYEMKATNF---------IGETTSTCKVAVL-------------TSE 1790
            ||:...|.|      ||.........|         :||.|.....|.:             :..
Mouse  5358 LTVRGWRLEVLEPPHDASVKAGMQVRFTCILSEAVPVGEATWYINGAAIQPDDTDWTVTTDGSHH 5422

  Fly  1791 ALSLEQ------------------TVTKTLIATTEEPEEGAV----------------------- 1814
            ||:|..                  :...:::|..:.||:..|                       
Mouse  5423 ALTLSNAQPQHAGEVTFAARDAVASARLSVLALPDPPEDAEVVGRSDHSVTLSWVAPMSDGGGGL 5487

  Fly  1815 ------------------------PEIVHVDVFQQHSY--------------------------- 1828
                                    ||.|..|:....:|                           
Mouse  5488 CGYRVEMKEASTGQWQLCHDLVPGPECVVDDLVPGKTYRFRVAAVGPAGAGEPVHLPQMVKIAPA 5552

  Fly  1829 ---------------------ESVPLKYEVIATGIPKPEAIWYHDGKPITPDKHTAITVDGDHYK 1872
                                 |.:.|:.||.|.|   .|.:|:...:.|.|..|..:...|....
Mouse  5553 PAPAPAPAPAPAPETRQAVVGEDICLELEVAADG---GEVVWHKGTERIQPGGHFEVLSRGQRQM 5614

  Fly  1873 LEVQSLDLVDAGEYK----------------VVVQNKVG-----------EKSHQGEL------- 1903
            |.::.....|.|||:                ||:.:..|           |.:.:|:|       
Mouse  5615 LVIKGFRTEDQGEYRCGPIQGLPSSGAATFNVVMTSGSGDEVPAQPSLPPEAAQEGDLHLLWEAL 5679

  Fly  1904 -------------SLSGI-------------AEYRKPILTQ------------------------ 1918
                         |:|.:             ||...|.|::                        
Mouse  5680 ARKRRMSREPTLDSISELPEEDSRVQHLRQEAEETAPDLSEGYSTADELARTGEADLSHTSSDDE 5744

  Fly  1919 ----------------GPGLKDIKVN---------KGDKVCEPVVFTADPAPEIVLLKDGQPVVE 1958
                            |||:..:...         |..|..||||.|..|..::.......|.::
Mouse  5745 SRAGTPSLVTYLKKAGGPGISPLASKHEAQVTTSVKPQKQQEPVVPTCPPPGDLSAADLMDPSLD 5809

  Fly  1959 TNNVKL-------KVDKK----------------DAENG-------------------------- 1974
            ...||:       ||.|:                :|:.|                          
Mouse  5810 KAAVKIQAAFKGYKVRKEMKQQEGPVFSRTFGDTEAQVGDVLRLECVLATKTDMRACWLKDGIEL 5874

  Fly  1975 ----------LVQYTCTLNILEAEIKDSGRYELKVKNKYGELVTSGWIDVL-----AKPEISG-L 2023
                      |...||:|.:......|||||..:|..|.|.:..|..:.|.     |:....| |
Mouse  5875 TDGRHYHIDQLKDGTCSLLVTGLAPTDSGRYTCQVSTKSGRVSHSACVVVSGTESEAESSSGGEL 5939

  Fly  2024 ND--------------TKCLPGDTICFEALVQAN-----PKPKVSWT--RGNEN-LCNHENCEVI 2066
            :|              ||. |.:....|..:.|:     |:....|.  |.:|| :|........
Mouse  5940 DDAFRRAARRLHRLFRTKS-PAELSEEELFLSADEGPGEPEEPADWQTYREDENFVCIRFESLAE 6003

  Fly  2067 ADVDADKYRLVFQS------VSPCEDGKYTITATNSEGRAAVDFNLAVLVEK----------PTF 2115
            |......:|.:|.:      :|..|.|...:..  ..|:.|.....||.:.|          |.|
Mouse  6004 ARQAVTCFRNMFATMGIGVEISLGEQGPRGVEM--RIGKVAPTVTPAVPLAKTPGLQTSDAAPVF 6066

  Fly  2116 IVQPESQSIHDYRPVSTKVLVHGVPLPTIEWFKDDKPINYEAINKPGKDKLYAKEDTKKGTDQIE 2180
            :.:.::|.:.|..|:|...:|.|.|:|::.||||.|.:.        :|..|...:.::|..|  
Mouse  6067 LTELQNQDVQDGYPMSFDCVVTGQPVPSVRWFKDGKLLE--------EDDHYMINEDQQGGHQ-- 6121

  Fly  2181 SVLDIKSFRENDVGAYTCVATNEIGV--TKAPFKLAMLSL------------------------- 2218
              |.|.:....|:|.|.|:|.|.:||  |||..::.:.|.                         
Mouse  6122 --LIITAVVPADMGVYRCLAENSMGVSSTKAELRVELTSTDYDTAADATETSSYFSAQGYLSSRE 6184

  Fly  2219 ----------APSFVKKLDNALDVLQGEPLV-LECCVDGSPLPTVQWLKDGDEVKPSESIKISTN 2272
                      .|..:::|.: |.|..|..|. .:..|.|.|.|.:.|.|||..:..|:.|:: |:
Mouse  6185 QEGTESDEGQLPQVLEELKD-LQVAPGTRLAKFQLKVKGYPAPKLYWFKDGQPLTTSDHIRM-TD 6247

  Fly  2273 PDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVK----PEE----------MQPKFLKP 2323
            ...|..|||.|....|||.|...|||..|...:...:.|:    |||          :.|:.|:.
Mouse  6248 KKTLHTLEIVSVTREDSGQYAAYISNAVGAAYSSARLLVRGPSEPEEKPASDVHERLVPPRILEK 6312

  Fly  2324 ITSQTVVVGEPLKLEAQVTGFPAPEVKWYKD----GML-LRP-SPEINFINSPNGQIGLIIDAAQ 2382
            .|.:.|..|..:....:|.|.|||.|.|.|:    |:| :.| :|.....:|......:::|..:
Mouse  6313 FTPKKVKRGSSITFSVKVEGHPAPSVHWLKEEAEKGVLWIGPDTPGYTMASSSKQHSLVLLDVGR 6377

  Fly  2383 PLDAGVYKCLIANKGGE--------IEGVSKVEIVPKESKPVFVAELQDASSI--------EGFP 2431
            . ..|.|.|:..|..|:        |.|::|.|...:..:.:..:.||..|..        .|| 
Mouse  6378 Q-HQGTYTCIATNPAGQALCSASLHISGLAKEEEQERVKEALISSFLQGTSQAVSAQMSESAGF- 6440

  Fly  2432 VKMDIKVVGNPKPKLQWFHNGHEIKPDASHIAIVE------------------------------ 2466
                ..:||..|.:.......|      ||:::.|                              
Mouse  6441 ----ADLVGQSKGESLVAEEAH------SHLSLAEVGTEEFLQKLTSQITEMVSAKISQAKLQVP 6495

  Fly  2467 ---------NPDNS--------SSLIIEKTAPGDSG--------LYEVIAQ-------------- 2492
                     .|..|        ||.:.|.::..:.|        :|.|.|.              
Mouse  6496 GGDSDEETKTPSASPRHGRSRPSSSVQESSSESEDGDSRGEIFDIYVVTADYLPLGAEQDAIILR 6560

  Fly  2493 --------------------NPEGSTASK----------AKLYVAPKADETATEEAP-------- 2519
                                .|..|:.|:          .:|.::|:...|...|.|        
Mouse  6561 EGQYVEVLDSAHPLRWLVRTKPTKSSPSRQGWVSPAYLDKRLKLSPEWGPTEAPEFPGEAVSEDE 6625

  Fly  2520 ---------------------------------------------------------------QF 2521
                                                                           .|
Mouse  6626 YRTRLSSVIQELLSSEQAFVGELQFLESHHMKHLERSPRVPAAVASQKTVIFRNVQDISHFHSSF 6690

  Fly  2522 VSALRDVNAD-------------------------EGQELVLSAP-------------------- 2541
            :..|:....|                         :.:.:|:|.|                    
Mouse  6691 LKELQGCGTDDDVAMCFIKNQEAFEKYLEFLVGRVQAESVVVSTPVQEFYKKYAEETLSAKDPTQ 6755

  Fly  2542 --------FISNP-------------------------------------MPEVIWSKDGVTL-- 2559
                    ::..|                                     :|:...:|..|:|  
Mouse  6756 PPPPPLQHYLEQPVERVQKYQALLKELIRNKARNRQNCALLEQAYAVVSALPQRAENKLHVSLME 6820

  Fly  2560 -----------------------TPNERLLMTCDGKHIGL------TIKPAEAADSGNYTCLLAN 2595
                                   .|..|:......:|:.|      ..||...:.:..::.:..|
Mouse  6821 NYPGTLEALGEPIRQGHFIVWEGAPGARMPWKGHNRHVFLFRNYLVICKPRRDSRTDTFSYVFRN 6885

  Fly  2596 PL------------GED------------------------------SSACNANVR---KVYKPP 2615
            .:            |:|                              ...|....|   .|::||
Mouse  6886 MMKLSSIDLNDQVEGDDRAFEVWHEREDSVRKYLLQARTVIIKNSWVKEICGIQQRLAQPVWRPP 6950

  Fly  2616 VFTQKISDQQQVFGNNAKIPVTVSGVPYPDLEWYFQDKPIPKSEKYSIKNDGDHH-MLIVNNCEK 2679
            .|.::::|.....|...|:...|:|.|.|.:.||...||:.....:.:..|.|.. .||::|...
Mouse  6951 EFEEELADCTAELGETVKLACRVTGTPKPIVSWYKDGKPVEVDPHHILIEDPDGSCTLILDNLTG 7015

  Fly  2680 GDQGVYKCIASNREGKDITQGRLDIVNEIKKHSRSEPPVFLKKIGDCDIYEGMVAKFTACATGYP 2744
            .|.|.|.|.|::..|...|.|::.:         ..||.|:.|:......||..|:.|....|.|
Mouse  7016 IDSGQYMCFAASAAGNASTLGKILV---------QVPPRFVNKVRATPFVEGEDAQITCTVEGAP 7071

  Fly  2745 EPEVEWFKNDQKLFPSDRFLIDIEP-NGLLRLTIKNVTEYDVGRYSCRIFNPYGDDICHAELFYD 2808
            .|::.|:|:...|.|.:|:.:..|| :|:|.|.|:..::.|:|.|.|.:.|..|......||:  
Mouse  7072 YPQIRWYKDGTLLAPGNRYRMLNEPRSGVLVLVIQAASKEDLGHYECELVNRLGSTRGGGELY-- 7134

  Fly  2809 SLDSQQKPLEDQYTDFKKYKKSGAPPPLSEGPIISRMTDRGLLLSWNPSVPLTPRYPITYQIEMM 2873
             :.|......||:               ....|::.:.|..:                       
Mouse  7135 -MQSPALRARDQH---------------HREQIVAAVEDTSV----------------------- 7160

  Fly  2874 DLPEGDWRTLRTGVRSCACDIRNLEPFRDYRFRVRVENKFGVSDPSPYTQTYRQKLVPDPPKTYT 2938
               ||...:.:.|....|..:         .:|:......|.| |.....| ||...|...:..:
Mouse  7161 ---EGSAHSAQDGADQQAASV---------LWRLLGSEALGPS-PGDLPNT-RQSEPPAFEEAAS 7211

  Fly  2939 YLPPGTDFRPETSPYFPKDFDIERP-PHDGLAQAPQFLLREQDISYGVKDHNTELMWFVYGYPKP 3002
            .:|......|...|      ::.:| .|.||.|        :..|.|.:           |:..|
Mouse  7212 QIPGAASGTPGELP------EVSQPGTHKGLEQ--------ETTSSGSQ-----------GWTVP 7251

  Fly  3003 KMTYYFDDMLIESGGRFDQSYTRNGQATLFINKMLDRDVGWYEAVATNEHGEARQRVRLEIAEHP 3067
                    :.:| |..:..:.|  ||..|        ||.....:.|.:.....|.....:...|
Mouse  7252 --------IRVE-GTAWPGAGT--GQLLL--------DVHSQVIMETTQRTYVCQAPDTGVTRAP 7297

  Fly  3068 RFLKRPDETFIMARKNGRIEAKLVGIPLPEVHWFKDWKPIVDSSRIKISSYDPDIYVLSIHDSII 3132
            ......::..:......:.:|.:.|.|.|.|.|:|....:..|:|:. ...|...|.|.:.|...
Mouse  7298 SMQVTIEDVQVQVGDMAQFDAVIEGHPPPIVTWYKGSTQLTSSARLS-QRQDGTTYSLVLTDVAP 7361

  Fly  3133 KDGGLYSISARNIAGSI--STSVTVHIEENED--QYIYKTYGRHPYVRSKQLRYQDKYDIGDELG 3193
            .|.|:|:..|.|..|.:  ...:.||..:..|  ..:|:.            :....||:.:|:|
Mouse  7362 HDAGVYTCVANNAGGQVLCKAELLVHGGDKLDAENQVYRR------------KLHSFYDVQEEIG 7414

  Fly  3194 RGTQGITYHAVERSSGDNYAAKIMYGRPELRPFMLNELEMMNTFNHKNLIRPYDAYDTDRSVTLI 3258
            ||..|.......:.:....|||.:..|.:.|.....|.:::.|..|..:....|.::|.:::.||
Mouse  7415 RGVFGFVKRVQHKGNKMFCAAKFIPLRSKTRAQAYQERDILATLGHPLVTGLLDQFETRKTLILI 7479

  Fly  3259 MELAAGGELVRDNLLRRDYYTERDIAHYIRQTLWGLEHMHEMGVGHMGLTIKDLLISVVGGDIIK 3323
            :||.:..||: |.|.::...||.::..||:|.:.||.::|..|:.|:.:...::|:.....:.||
Mouse  7480 LELCSSEELL-DRLFKKGVVTEAEVKVYIQQLVEGLHYLHSHGILHLDIKPPNILMVHPAREDIK 7543

  Fly  3324 VSDFGLSRKINRHNLSTLDYGMPEFVSPEVVNKEGVNFSHDMWTVGLITYVLLGGHNPFLGIDDR 3388
            :.|||.::||.........||.|||||||::.:..|:...|:|.:|:|:|:.|...:||.|..||
Mouse  7544 ICDFGFAQKITPSEPQYSKYGSPEFVSPEIIEQNPVSEGSDIWAMGVISYLSLTCSSPFAGESDR 7608

  Fly  3389 ETLTKIREGRWDFKDEIWTHISDDGRDFISRLLLYSPEERMDVKTALKHPWF------------- 3440
            .||..:.|||..:......|:|:|.:|||...|..:|..|......|.||||             
Mouse  7609 ATLLNVLEGRVSWSSPTAAHLSEDAKDFIKATLQRTPRARPSTSQCLAHPWFLKSMPAEEAHFIN 7673

  Fly  3441 -----FMLDRPVYDHDY-----------------------QIGTDRLRNYYDHFRDWYANASCKN 3477
                 |:|.|..:....                       .:|..|      |.|...:.||..:
Mouse  7674 TKQLKFLLARSRWQRSLMSYKSILVMRSIPELLQGPPDSPSLGVAR------HLRGEASGASSSS 7732

  Fly  3478 ----------------------------------------------------------------- 3477
                                                                             
Mouse  7733 SSSDNELAPFARAKSLPPSPVTHSPLLHPRGFLRPSASLPEETEASMPTADAAVPASPQSAGPPA 7797

  Fly  3478 --------------YF--------RRRRLSGCFQHPSK---------------------MVYP-- 3497
                          ::        |..:.||..:||::                     |.|.  
Mouse  7798 SPGCVPRHSVISSLFYQQAGEGAERGNKTSGAKRHPARRRHLLKGGYIARALPGLREPLMEYSLL 7862

  Fly  3498 ---------------------------------PGHVYTPENTP---EPLPE--------PRIRA 3518
                                             ||..::.:|.|   .|.||        |....
Mouse  7863 EEEAAREEQASLMTKTPSFETALRLPSSSVREVPGRSHSLDNPPVTTGPSPEACKEQLLFPPSTG 7927

  Fly  3519 KREEVVSK-------YL-------------HPDYELGLIQ--------SESHYQYG--------- 3546
            ...|..:|       :|             .|..:.|..|        |..|.:.|         
Mouse  7928 LTHETTAKDRGHKEGFLQESVPFPPMSGDSRPGKQEGSSQDSCRGKPASSCHSELGSGSQEGCGP 7992

  Fly  3547 PDTYLL----------------------QLRDVNFPVR---------------LREYMKVAHRRS 3574
            |.:..|                      |.:...||.:               |.|........|
Mouse  7993 PSSQSLGSLPPQSLKKELSTSCGPLFSEQPQAAPFPTQVSPLLGSEKEPQDGSLSEGPVPVPSSS 8057

  Fly  3575 PSFA--------------LNDSVDWSLPVIRER-----RRFT----------------------- 3597
            |..|              ..|:.|::.|..|.:     |:|:                       
Mouse  8058 PGSASQVDASLDTEGLSEAGDTCDFTPPPQRPQEQATTRKFSLESRGGYAGVAGYGTFAFGGDAG 8122

  Fly  3598 ----------------DIMDEEIDDERTRS-------------------------------RISM 3615
                            ....||.|:..|.|                               ::|:
Mouse  8123 GMLGQGPLWARMAWAVSQSSEEQDEAATESPQPLESLGPIAEASGVPLRTSPSLTPWEEVEQVSL 8187

  Fly  3616 Y----------AA-----------------NESYSIRRL----------------------RTEL 3631
            .          ||                 ::.|.|:.|                      .||.
Mouse  8188 VQIRDLSGDAEAADTISLDISEVDPAYLNLSDLYDIKYLPFEFMIFRRVPKPIEQPESPGSETEA 8252

  Fly  3632 GPRLDEYTEADAM---------------------------------------------------- 3644
            |..|.::.|..|.                                                    
Mouse  8253 GQGLADFLEEAAWPWPGELGLRAGLEITEEPEEPGDLEALLGEAAVGRKRKWSPSRGLFQFPGRC 8317

  Fly  3645 ------IE------------------------TQREGYPP-------FFR--------EKPQTIA 3664
                  :|                        .:||| ||       .||        ::....|
Mouse  8318 LSGEEPVELGLRQRVKASMAHISRILKGRPEGPEREG-PPRKKAGLASFRLSGLKGRDQELSDEA 8381

  Fly  3665 ITENQPSHIHCFAVGDPKPCVQWFKNDMVLTESKRIKISVDEDGRSILRFEPALHFDVGVYKVVA 3729
            :...|...:.|..:..|.....|.|:.::|..|..:.||.......:|........|:|.|....
Mouse  8382 VVLGQSVTLACQVLAQPTAQATWSKDGVLLESSGHLLISSTLKNFQLLTILVVKEEDLGTYTCCV 8446

  Fly  3730 RNKVGQTVARCRIVVATLPDAPDSPEISANSGTEILLRWKQPRDDGHSTVLCYSLQYKLSNC--- 3791
            .|.:|..|....:..|..|.:...||:.......:||.||....       |..:.|.:..|   
Mouse  8447 SNPLGTAVTTGVLRKAERPSSSPRPEVGELYKDAVLLVWKPVES-------CGPVTYIVQCCIEG 8504

  Fly  3792 DAWTTVADNIDHEFYLLHDLQPNTNYQFRLASKNRIGWSEMGIPVSASTVGGDAPKIHITKAMKH 3856
            .:|||:|.:|....||...|.....|.||.|..::.|......|.....:||.          .|
Mouse  8505 GSWTTLASDISDCCYLTGKLSRGGMYIFRTACVSKAGMGPYSSPSEQVLLGGP----------NH 8559

  Fly  3857 LQQLTENGHQVVPEEERVHTDYHCEREPPNWVTDSSVSDKYSFISEIARGEFSTIVKGIQKSTDT 3921
            |          ..|||       ..|..|..:..|:.:  ::|..:|.||.||.:.:..:|::..
Mouse  8560 L----------ASEEE-------SSRGRPAQLLPSTKT--FAFQMQIRRGRFSVVRQCREKASGR 8605

  Fly  3922 VVVAKILEVTDENEDNVVAEFDNFKTLRHERIPALFSAYKPLNVPIAIFVMEKLQGADVLTYFSS 3986
            .:.|||:....|::..|:.|::..|.|.|..:..|.:||  |:....:.::|...|.::|...:.
Mouse  8606 ALAAKIVPYQPEDKTAVLREYEALKRLHHPHLAQLHAAY--LSPRHLVLILELCSGPELLPSLAE 8668

  Fly  3987 RHEYSEQMVATVVTQLLDALQYLHWRGYCHLNIQPDNVVMASVRSIQVKLVDFGSAKKVNKLGMK 4051
            |..|||..|...:.|:|.|.||||.:...||:::.:|:::.....:  |::|.|:|:   .|..:
Mouse  8669 RESYSESDVKDYLWQMLSATQYLHAQHILHLDLRSENMMVTEYNLL--KVIDLGNAQ---SLDQE 8728

  Fly  4052 VTPCGS-----LDFQPPEMINDEPIFPQSDIWSLGALTYLLLSGCSPFRGADEYETKQNISFVRY 4111
            ..|...     |:...||::..:...||:|||::|...:::|||..|.......:.::.:.....
Mouse  8729 KVPAPENFKDYLETMAPELLEGQGAVPQTDIWAIGVTAFIMLSGEYPESSEGTRDLQKGLRKGLI 8793

  Fly  4112 RFENLFKEVTPEATRFIMLLFKRHPTKRPYTEDCLEHRWLMSSDYMVRKRERAIFLGSRLKTFCD 4176
            |....:..::..|..|:.......|..||....||:..||........:.....|...||:.|..
Mouse  8794 RLSRCYAGLSGGAVAFLQSSLCAQPWGRPCASTCLQCGWLTEEGPTGSRPTPVTFPTVRLRAFVR 8858

  Fly  4177 E 4177
            |
Mouse  8859 E 8859

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ObscNP_001097440.1 RhoGEF 90..260 CDD:238091
PH_unc89 275..388 CDD:270134
Not5 <477..>652 CDD:444384
Ig 1017..1108 CDD:472250 25/93 (27%)
Ig strand B 1034..1038 CDD:409353 1/3 (33%)
Ig strand C 1046..1050 CDD:409353 1/3 (33%)
Ig strand E 1074..1078 CDD:409353 1/3 (33%)
Ig strand F 1088..1093 CDD:409353 1/4 (25%)
Ig strand G 1101..1104 CDD:409353 0/2 (0%)
I-set 1123..1212 CDD:400151 21/88 (24%)
Ig strand B 1140..1144 CDD:409353 0/3 (0%)
Ig strand C 1153..1157 CDD:409353 0/3 (0%)
Ig strand E 1182..1186 CDD:409353 2/3 (67%)
Ig strand F 1196..1201 CDD:409353 3/4 (75%)
Ig strand G 1209..1212 CDD:409353 0/2 (0%)
Ig <1236..1299 CDD:472250 18/72 (25%)
Ig strand C 1238..1242 CDD:409353 0/3 (0%)
Ig strand E 1259..1269 CDD:409353 2/10 (20%)
Ig strand F 1279..1284 CDD:409353 3/6 (50%)
Ig strand G 1292..1295 CDD:409353 0/2 (0%)
I-set 1313..1403 CDD:400151 17/89 (19%)
Ig strand B 1330..1334 CDD:409353 0/3 (0%)
Ig strand C 1343..1347 CDD:409353 1/3 (33%)
Ig strand E 1369..1373 CDD:409353 1/3 (33%)
Ig strand F 1383..1388 CDD:409353 2/4 (50%)
Ig strand G 1396..1399 CDD:409353 1/2 (50%)
Ig_3 1406..1487 CDD:464046 19/87 (22%)
I-set 1499..1595 CDD:400151 25/114 (22%)
Ig strand B 1522..1526 CDD:409353 1/3 (33%)
Ig strand C 1535..1539 CDD:409353 0/3 (0%)
Ig strand E 1561..1565 CDD:409353 1/3 (33%)
Ig strand F 1575..1580 CDD:409353 0/4 (0%)
Ig strand G 1588..1591 CDD:409353 1/2 (50%)
Ig 1599..1690 CDD:472250 24/99 (24%)
Ig strand B 1617..1621 CDD:409353 2/3 (67%)
Ig strand C 1630..1634 CDD:409353 1/3 (33%)
Ig strand E 1656..1660 CDD:409353 1/3 (33%)
Ig strand F 1670..1675 CDD:409353 1/4 (25%)
Ig strand G 1683..1686 CDD:409353 0/2 (0%)
I-set 1694..1786 CDD:400151 27/132 (20%)
Ig strand B 1711..1715 CDD:409353 0/3 (0%)
Ig strand C 1724..1728 CDD:409353 0/3 (0%)
Ig strand E 1752..1756 CDD:409353 1/3 (33%)
Ig strand F 1766..1771 CDD:409353 0/4 (0%)
Ig strand G 1779..1782 CDD:409353 1/2 (50%)
Ig <1836..1903 CDD:472250 20/93 (22%)
Ig strand C 1846..1850 CDD:409353 1/3 (33%)
Ig strand E 1871..1875 CDD:409353 1/3 (33%)
Ig strand F 1885..1890 CDD:409353 3/20 (15%)
Ig 1922..2005 CDD:472250 27/150 (18%)
Ig strand B 1933..1937 CDD:409353 1/3 (33%)
Ig strand C 1946..1950 CDD:409353 0/3 (0%)
Ig strand E 1971..1984 CDD:409353 6/48 (13%)
Ig strand F 1994..1999 CDD:409353 2/4 (50%)
Ig 2018..2108 CDD:472250 22/118 (19%)
Ig strand B 2034..2038 CDD:409353 0/3 (0%)
Ig strand C 2047..2051 CDD:409353 0/3 (0%)
Ig strand E 2074..2078 CDD:409353 1/3 (33%)
Ig strand F 2088..2093 CDD:409353 0/4 (0%)
Ig strand G 2101..2104 CDD:409353 1/2 (50%)
Ig 2113..2214 CDD:472250 32/102 (31%)
Ig strand B 2130..2134 CDD:409353 1/3 (33%)
Ig strand C 2143..2147 CDD:409353 0/3 (0%)
Ig strand E 2176..2185 CDD:409353 2/8 (25%)
Ig strand F 2195..2200 CDD:409353 2/4 (50%)
I-set 2220..2302 CDD:400151 29/82 (35%)
Ig strand B 2238..2242 CDD:409353 1/4 (25%)
Ig strand C 2251..2255 CDD:409353 0/3 (0%)
Ig strand E 2277..2281 CDD:409353 1/3 (33%)
Ig strand F 2291..2296 CDD:409353 1/4 (25%)
Ig strand G 2304..2307 CDD:409353 0/2 (0%)
I-set 2318..2408 CDD:400151 27/103 (26%)
Ig strand B 2335..2339 CDD:409353 0/3 (0%)
Ig strand C 2348..2352 CDD:409353 1/3 (33%)
Ig strand E 2374..2378 CDD:409353 0/3 (0%)
Ig strand F 2388..2393 CDD:409353 2/4 (50%)
Ig 2415..2506 CDD:472250 25/197 (13%)
Ig strand B 2432..2436 CDD:409353 0/3 (0%)
Ig strand C 2445..2449 CDD:409353 0/3 (0%)
Ig strand E 2472..2476 CDD:409353 2/3 (67%)
Ig strand F 2486..2491 CDD:409353 2/4 (50%)
Ig strand G 2499..2502 CDD:409353 1/12 (8%)
I-set 2519..2608 CDD:400151 22/322 (7%)
Ig strand B 2536..2540 CDD:409353 1/3 (33%)
Ig strand C 2549..2553 CDD:409353 0/3 (0%)
Ig strand E 2574..2578 CDD:409353 1/9 (11%)
Ig strand F 2588..2593 CDD:409353 0/4 (0%)
I-set 2615..2696 CDD:400151 24/81 (30%)
Ig strand B 2632..2636 CDD:409353 1/3 (33%)
Ig strand C 2645..2649 CDD:409353 0/3 (0%)
Ig strand E 2670..2674 CDD:409353 1/4 (25%)
Ig strand F 2684..2689 CDD:409353 2/4 (50%)
Ig strand G 2697..2700 CDD:409353 1/2 (50%)
I-set 2717..2805 CDD:400151 27/88 (31%)
Ig strand B 2734..2738 CDD:409353 1/3 (33%)
Ig strand C 2747..2751 CDD:409353 0/3 (0%)
Ig strand E 2773..2777 CDD:409353 2/3 (67%)
Ig strand F 2787..2792 CDD:409353 2/4 (50%)
Ig strand G 2800..2803 CDD:409353 0/2 (0%)
FN3 2834..2925 CDD:238020 10/90 (11%)
Ig <2996..3063 CDD:472250 12/66 (18%)
Ig strand C 3003..3007 CDD:409353 0/3 (0%)
Ig strand E 3029..3033 CDD:409353 1/3 (33%)
Ig strand F 3043..3048 CDD:409353 0/4 (0%)
Ig strand G 3056..3059 CDD:409353 1/2 (50%)
Ig 3067..3157 CDD:472250 21/91 (23%)
Ig strand B 3085..3088 CDD:409353 0/2 (0%)
Ig strand C 3097..3101 CDD:409353 1/3 (33%)
Ig strand E 3123..3127 CDD:409353 2/3 (67%)
Ig strand F 3137..3142 CDD:409353 1/4 (25%)
Ig strand G 3150..3153 CDD:409353 0/2 (0%)
PK_Unc-89_rpt1 3182..3440 CDD:271011 81/257 (32%)
Ig 3654..3744 CDD:472250 20/104 (19%)
Ig strand B 3671..3675 CDD:409353 0/3 (0%)
Ig strand C 3684..3688 CDD:409353 0/3 (0%)
Ig strand E 3710..3714 CDD:409353 1/3 (33%)
Ig strand F 3724..3729 CDD:409353 1/4 (25%)
Ig strand G 3737..3740 CDD:409353 1/2 (50%)
FN3 3748..3840 CDD:238020 24/94 (26%)
STKc_Unc-89_rpt2 3893..4151 CDD:271014 65/262 (25%)
ObscnNP_001415297.1 I-set 9..98 CDD:400151
Ig strand B 26..30 CDD:409353
Ig strand C 39..43 CDD:409353
Ig strand E 61..65 CDD:409353
Ig strand F 78..83 CDD:409353
I-set 109..200 CDD:400151
Ig strand B 126..130 CDD:409353
Ig strand C 139..143 CDD:409353
Ig strand E 166..170 CDD:409353
Ig strand F 180..185 CDD:409353
Ig strand G 193..196 CDD:409353
I-set 246..326 CDD:400151
Ig strand B 253..257 CDD:409353
Ig strand C 266..270 CDD:409353
Ig strand E 292..296 CDD:409353
Ig strand F 306..311 CDD:409353
Ig strand G 319..322 CDD:409353
Ig 333..416 CDD:472250
Ig strand B 348..352 CDD:409353
Ig strand C 360..364 CDD:409353
Ig strand E 385..389 CDD:409353
Ig strand F 399..404 CDD:409353
Ig 422..503 CDD:472250
Ig strand B 436..440 CDD:409353
Ig strand C 448..452 CDD:409353
Ig strand E 473..477 CDD:409353
Ig strand F 487..492 CDD:409353
Ig strand G 496..499 CDD:409353
FN3 513..600 CDD:238020
Ig 615..>671 CDD:472250
Ig 709..789 CDD:472250
Ig strand B 722..726 CDD:409353
Ig strand C 734..738 CDD:409353
Ig strand E 759..763 CDD:409353
Ig strand F 773..778 CDD:409353
Ig strand G 782..785 CDD:409353
Ig 800..881 CDD:472250
Ig strand B 814..818 CDD:409353
Ig strand C 826..830 CDD:409353
Ig strand E 851..855 CDD:409353
Ig strand F 865..870 CDD:409353
Ig strand G 874..877 CDD:409353
Ig 892..973 CDD:472250
Ig strand B 906..910 CDD:409353
Ig strand C 918..922 CDD:409353
Ig strand E 943..947 CDD:409353
Ig strand F 957..962 CDD:409353
Ig strand G 966..969 CDD:409353
Ig 984..1065 CDD:472250
Ig strand B 998..1002 CDD:409353
Ig strand C 1010..1014 CDD:409353
Ig strand E 1035..1039 CDD:409353
Ig strand F 1049..1054 CDD:409353
Ig strand G 1058..1061 CDD:409353
Ig 1076..1157 CDD:472250
Ig strand B 1090..1094 CDD:409353
Ig strand C 1102..1106 CDD:409353
Ig strand E 1127..1131 CDD:409353
Ig strand F 1141..1146 CDD:409353
Ig strand G 1150..1153 CDD:409353
Ig 1168..1249 CDD:472250
Ig strand B 1182..1186 CDD:409353
Ig strand C 1194..1198 CDD:409353
Ig strand E 1219..1223 CDD:409353
Ig strand F 1233..1238 CDD:409353
Ig strand G 1242..1245 CDD:409353
Ig 1260..1341 CDD:472250
Ig strand B 1274..1278 CDD:409353
Ig strand C 1286..1290 CDD:409353
Ig strand E 1311..1315 CDD:409353
Ig strand F 1325..1330 CDD:409353
Ig strand G 1334..1337 CDD:409353
Ig 1352..1433 CDD:472250
Ig strand B 1366..1370 CDD:409353
Ig strand C 1378..1382 CDD:409353
Ig strand E 1403..1407 CDD:409353
Ig strand F 1417..1422 CDD:409353
Ig strand G 1426..1429 CDD:409353
Ig 1444..1525 CDD:472250
Ig strand B 1458..1462 CDD:409353
Ig strand C 1470..1474 CDD:409353
Ig strand E 1495..1499 CDD:409353
Ig strand F 1509..1514 CDD:409353
Ig strand G 1518..1521 CDD:409353
Ig 1536..1617 CDD:472250
Ig strand B 1550..1554 CDD:409353
Ig strand C 1562..1566 CDD:409353
Ig strand E 1587..1591 CDD:409353
Ig strand F 1601..1606 CDD:409353
Ig strand G 1610..1613 CDD:409353
Ig 1628..1709 CDD:472250
Ig strand B 1642..1646 CDD:409353
Ig strand C 1654..1658 CDD:409353
Ig strand E 1679..1683 CDD:409353
Ig strand F 1693..1698 CDD:409353
Ig strand G 1702..1705 CDD:409353
Ig 1720..1801 CDD:472250
Ig strand B 1734..1738 CDD:409353
Ig strand C 1746..1750 CDD:409353
Ig strand E 1771..1775 CDD:409353
Ig strand F 1785..1790 CDD:409353
Ig strand G 1794..1797 CDD:409353
Ig 1812..1893 CDD:472250
Ig strand B 1826..1830 CDD:409353
Ig strand C 1838..1842 CDD:409353
Ig strand E 1863..1867 CDD:409353
Ig strand F 1877..1882 CDD:409353
Ig strand G 1886..1889 CDD:409353
Ig 1904..1985 CDD:472250
Ig strand B 1918..1922 CDD:409353
Ig strand C 1930..1934 CDD:409353
Ig strand E 1955..1959 CDD:409353
Ig strand F 1969..1974 CDD:409353
Ig strand G 1978..1981 CDD:409353
Ig 1996..2077 CDD:472250
Ig strand B 2010..2014 CDD:409353
Ig strand C 2022..2026 CDD:409353
Ig strand E 2047..2051 CDD:409353
Ig strand F 2061..2066 CDD:409353
Ig strand G 2070..2073 CDD:409353
Ig 2093..2159 CDD:472250
Ig strand B 2102..2106 CDD:409353
Ig strand C 2115..2119 CDD:409353
Ig strand E 2140..2144 CDD:409353
Ig strand F 2154..2159 CDD:409353
Ig 2179..2259 CDD:472250
Ig strand B 2192..2196 CDD:409353
Ig strand C 2204..2208 CDD:409353
Ig strand E 2229..2233 CDD:409353
Ig strand F 2243..2248 CDD:409353
Ig strand G 2252..2255 CDD:409353
Ig 2266..2349 CDD:472250
Ig strand B 2282..2286 CDD:409353
Ig strand C 2294..2298 CDD:409353
Ig strand E 2319..2323 CDD:409353
Ig strand F 2333..2338 CDD:409353
Ig strand G 2342..2345 CDD:409353
Ig 2356..2439 CDD:472250
Ig strand B 2371..2375 CDD:409353
Ig strand C 2383..2387 CDD:409353
Ig strand E 2408..2412 CDD:409353
Ig strand F 2422..2427 CDD:409353
Ig 2533..2615 CDD:472250
Ig strand B 2549..2553 CDD:409353
Ig strand C 2560..2564 CDD:409353
Ig strand E 2585..2589 CDD:409353
Ig strand F 2599..2604 CDD:409353
Ig strand G 2608..2611 CDD:409353
Ig 2621..2704 CDD:472250
Ig strand B 2637..2641 CDD:409353
Ig strand C 2650..2653 CDD:409353
Ig strand E 2674..2678 CDD:409353
Ig strand F 2688..2693 CDD:409353
Ig 2712..2793 CDD:472250
Ig strand B 2726..2730 CDD:409353
Ig strand C 2738..2742 CDD:409353
Ig strand E 2763..2767 CDD:409353
Ig strand F 2777..2782 CDD:409353
Ig strand G 2786..2789 CDD:409353
I-set 2889..2972 CDD:400151
Ig strand B 2905..2909 CDD:409353
Ig strand C 2918..2921 CDD:409353
Ig strand E 2942..2946 CDD:409353
Ig strand F 2956..2961 CDD:409353
Ig 2979..3061 CDD:472250
Ig strand B 2995..2998 CDD:409353
Ig strand C 3006..3010 CDD:409353
Ig strand E 3031..3035 CDD:409353
Ig strand G 3054..3057 CDD:409353
Ig 3067..3150 CDD:472250
Ig strand B 3083..3087 CDD:409353
Ig strand C 3095..3099 CDD:409353
Ig strand E 3120..3124 CDD:409353
Ig strand F 3134..3139 CDD:409353
Ig 3157..>3225 CDD:472250
Ig 3256..3330 CDD:472250
Ig strand B 3263..3267 CDD:409353
Ig strand C 3275..3279 CDD:409353
Ig strand E 3300..3304 CDD:409353
Ig strand F 3314..3319 CDD:409353
Ig strand G 3323..3326 CDD:409353
Ig 3336..3419 CDD:472250
Ig strand B 3352..3356 CDD:409353
Ig strand C 3364..3368 CDD:409353
Ig strand E 3389..3393 CDD:409353
Ig 3427..3510 CDD:472250
Ig strand B 3441..3445 CDD:409353
Ig strand C 3454..3458 CDD:409353
Ig strand E 3480..3484 CDD:409353
Ig strand G 3503..3506 CDD:409353
Ig 3517..3599 CDD:472250
Ig strand B 3532..3536 CDD:409353
Ig strand C 3544..3548 CDD:409353
Ig strand E 3569..3573 CDD:409353
Ig strand F 3583..3588 CDD:409353
Ig strand G 3592..3595 CDD:409353
I-set 3605..3688 CDD:400151
Ig strand B 3621..3625 CDD:409353
Ig strand C 3634..3637 CDD:409353
Ig strand E 3659..3662 CDD:409353
Ig strand G 3681..3684 CDD:409353
Ig 3694..3776 CDD:472250
Ig strand B 3710..3714 CDD:409353
Ig strand C 3721..3725 CDD:409353
Ig strand E 3746..3750 CDD:409353
Ig strand F 3760..3765 CDD:409353
Ig strand G 3769..3772 CDD:409353
I-set 3782..3864 CDD:400151
Ig strand B 3798..3802 CDD:409353
Ig strand C 3810..3813 CDD:409353
Ig strand E 3834..3838 CDD:409353
Ig strand F 3848..3853 CDD:409353
Ig strand G 3857..3860 CDD:409353
Ig 3875..3952 CDD:472250
Ig strand B 3886..3890 CDD:409353
Ig strand C 3897..3901 CDD:409353
Ig strand E 3922..3926 CDD:409353
Ig strand F 3936..3941 CDD:409353
Ig strand G 3945..3948 CDD:409353
Ig 3958..>4026 CDD:472250
Ig strand B 3974..3978 CDD:409353
Ig strand C 3986..3989 CDD:409353
Ig strand E 4010..4014 CDD:409353
Ig 4031..4113 CDD:472250
Ig strand B 4047..4051 CDD:409353
Ig strand C 4058..4062 CDD:409353
Ig strand E 4083..4087 CDD:409353
Ig strand F 4097..4102 CDD:409353
Ig strand G 4106..4109 CDD:409353
Ig 4119..4201 CDD:472250
Ig strand B 4135..4139 CDD:409353
Ig strand C 4147..4150 CDD:409353
Ig strand E 4171..4175 CDD:409353
Ig strand F 4185..4190 CDD:409353
Ig strand G 4194..4197 CDD:409353
Ig 4206..4289 CDD:472250
Ig strand B 4223..4227 CDD:409353
Ig strand C 4235..4238 CDD:409353
Ig strand E 4259..4263 CDD:409353
Ig strand F 4273..4278 CDD:409353
Ig strand G 4282..4285 CDD:409353
Ig 4294..4377 CDD:472250
Ig strand B 4311..4315 CDD:409353
Ig strand C 4323..4326 CDD:409353
Ig strand E 4347..4351 CDD:409353
Ig strand F 4361..4366 CDD:409353
Ig strand G 4370..4373 CDD:409353
Ig 4382..4465 CDD:472250
Ig strand B 4399..4403 CDD:409353
Ig strand C 4410..4414 CDD:409353
Ig strand E 4435..4439 CDD:409353
Ig strand F 4449..4454 CDD:409353
Ig strand G 4458..4461 CDD:409353
Ig 4470..4553 CDD:472250
Ig strand B 4487..4491 CDD:409353
Ig strand C 4499..4502 CDD:409353
Ig strand E 4523..4527 CDD:409353
Ig strand F 4537..4542 CDD:409353
Ig strand G 4546..4549 CDD:409353
Ig 4558..4641 CDD:472250 14/72 (19%)
Ig strand B 4575..4579 CDD:409353 2/3 (67%)
Ig strand C 4587..4590 CDD:409353 1/2 (50%)
Ig strand E 4611..4615 CDD:409353 0/3 (0%)
Ig strand G 4634..4637 CDD:409353 0/2 (0%)
Ig 4646..4729 CDD:472250 25/93 (27%)
Ig strand B 4663..4667 CDD:409353 1/3 (33%)
Ig strand C 4675..4678 CDD:409353 1/2 (50%)
Ig strand E 4699..4703 CDD:409353 1/3 (33%)
Ig strand F 4713..4718 CDD:409353 1/6 (17%)
Ig strand G 4722..4725 CDD:409353 1/4 (25%)
Ig 4735..4817 CDD:472250 21/87 (24%)
Ig strand B 4751..4755 CDD:409353 0/3 (0%)
Ig strand C 4763..4766 CDD:409353 0/2 (0%)
Ig strand E 4787..4791 CDD:409353 2/3 (67%)
Ig strand F 4801..4806 CDD:409353 3/4 (75%)
Ig strand G 4810..4813 CDD:409353 0/2 (0%)
Ig 4823..4906 CDD:472250 20/90 (22%)
Ig strand B 4839..4843 CDD:409353 0/3 (0%)
Ig strand C 4851..4855 CDD:409353 0/3 (0%)
Ig strand E 4876..4880 CDD:409353 2/3 (67%)
Ig strand F 4890..4895 CDD:409353 1/4 (25%)
Ig strand G 4899..4902 CDD:409353 1/2 (50%)
Ig 4912..4995 CDD:472250 24/114 (21%)
Ig strand B 4928..4932 CDD:409353 1/3 (33%)
Ig strand C 4940..4944 CDD:409353 1/3 (33%)
Ig strand E 4965..4969 CDD:409353 1/3 (33%)
Ig strand F 4979..4984 CDD:409353 2/4 (50%)
Ig strand G 4988..4991 CDD:409353 1/2 (50%)
Ig 5012..5086 CDD:472250 18/95 (19%)
Ig strand B 5017..5021 CDD:409353 0/3 (0%)
Ig strand C 5031..5035 CDD:409353 2/3 (67%)
Ig strand E 5056..5060 CDD:409353 1/3 (33%)
Ig strand F 5070..5075 CDD:409353 3/5 (60%)
Ig strand G 5079..5082 CDD:409353 0/2 (0%)
Ig 5093..5178 CDD:472250 21/95 (22%)
Ig strand B 5108..5112 CDD:409353 1/3 (33%)
Ig strand C 5121..5125 CDD:409353 0/3 (0%)
Ig strand E 5146..5152 CDD:409353 1/5 (20%)
Ig 5181..5269 CDD:472250 24/99 (24%)
Ig strand B 5200..5204 CDD:409353 1/3 (33%)
Ig strand C 5213..5217 CDD:409353 1/3 (33%)
Ig strand E 5236..5240 CDD:409353 1/3 (33%)
Ig strand G 5262..5265 CDD:409353 0/2 (0%)
Ig 5275..5360 CDD:472250 18/85 (21%)
IG_like 5371..5452 CDD:214653 10/80 (13%)
Ig strand B 5382..5386 CDD:409353 1/3 (33%)
Ig strand C 5396..5400 CDD:409353 2/3 (67%)
Ig strand E 5422..5426 CDD:409353 2/3 (67%)
Ig strand F 5436..5441 CDD:409353 0/4 (0%)
Ig strand G 5445..5448 CDD:409353 0/2 (0%)
FN3 5456..5541 CDD:238020 8/84 (10%)
Ig 5569..5630 CDD:472250 17/63 (27%)
Ig strand B 5576..5580 CDD:409353 1/3 (33%)
Ig strand C 5588..5592 CDD:409353 1/3 (33%)
Ig strand E 5613..5617 CDD:409353 1/3 (33%)
Ig 5834..5924 CDD:472250 15/89 (17%)
Ig strand B 5851..5855 CDD:409353 0/3 (0%)
Ig strand C 5864..5868 CDD:409353 0/3 (0%)
Ig strand E 5890..5894 CDD:409353 2/3 (67%)
Ig strand F 5904..5909 CDD:409353 2/4 (50%)
Ig strand G 5917..5920 CDD:409353 0/2 (0%)
I-set 6064..6154 CDD:400151 32/101 (32%)
Ig strand B 6081..6085 CDD:409353 1/3 (33%)
Ig strand C 6094..6098 CDD:409353 0/3 (0%)
Ig strand E 6120..6124 CDD:409353 2/7 (29%)
Ig strand F 6134..6139 CDD:409353 2/4 (50%)
Ig strand G 6147..6150 CDD:409353 1/2 (50%)
I-set 6196..6286 CDD:400151 30/91 (33%)
Ig strand B 6214..6218 CDD:409353 0/3 (0%)
Ig strand C 6227..6231 CDD:409353 0/3 (0%)
Ig strand E 6252..6256 CDD:409353 1/3 (33%)
Ig strand F 6266..6271 CDD:409353 1/4 (25%)
Ig strand G 6279..6282 CDD:409353 0/2 (0%)
I-set 6307..6402 CDD:400151 24/95 (25%)
Ig strand B 6324..6328 CDD:409353 0/3 (0%)
Ig strand C 6337..6341 CDD:409353 1/3 (33%)
Ig strand E 6368..6372 CDD:409353 0/3 (0%)
Ig strand F 6382..6387 CDD:409353 2/4 (50%)
Ig strand G 6395..6398 CDD:409353 0/2 (0%)
SH3_Obscurin_like 6538..6600 CDD:212958 6/61 (10%)
RhoGEF 6633..6809 CDD:470622 8/175 (5%)
PH_Obscurin 6818..6942 CDD:270059 11/123 (9%)
IgI_1_Titin-A168_like 6950..7040 CDD:409563 26/89 (29%)
Ig strand A' 6955..6961 CDD:409563 1/5 (20%)
Ig strand B 6966..6974 CDD:409563 1/7 (14%)
Ig strand C 6980..6985 CDD:409563 1/4 (25%)
Ig strand C' 6988..6990 CDD:409563 1/1 (100%)
Ig strand D 6996..7003 CDD:409563 1/6 (17%)
Ig strand E 7006..7012 CDD:409563 2/5 (40%)
Ig strand F 7019..7027 CDD:409563 4/7 (57%)
Ig strand G 7030..7040 CDD:409563 3/9 (33%)
I-set 7044..7126 CDD:400151 26/81 (32%)
Ig strand B 7061..7065 CDD:409353 1/3 (33%)
Ig strand C 7074..7078 CDD:409353 0/3 (0%)
Ig strand E 7101..7105 CDD:409353 2/3 (67%)
Ig strand F 7115..7120 CDD:409353 2/4 (50%)
Ig strand G 7128..7131 CDD:409353 0/2 (0%)
I-set 7297..7386 CDD:400151 20/89 (22%)
Ig strand B 7314..7318 CDD:409353 0/3 (0%)
Ig strand C 7327..7331 CDD:409353 1/3 (33%)
Ig strand E 7353..7356 CDD:409353 1/2 (50%)
Ig strand F 7366..7371 CDD:409353 1/4 (25%)
Ig strand G 7379..7382 CDD:409353 0/2 (0%)
Protein Kinases, catalytic domain 7404..7660 CDD:473864 81/256 (32%)
Ig 8374..8453 CDD:472250 16/78 (21%)
Ig strand B 8388..8392 CDD:409353 0/3 (0%)
Ig strand C 8401..8405 CDD:409353 0/3 (0%)
Ig strand E 8426..8431 CDD:409353 1/4 (25%)
Ig strand F 8441..8446 CDD:409353 1/4 (25%)
Ig strand G 8455..8458 CDD:409353 0/2 (0%)
FN3 8465..8543 CDD:214495 23/84 (27%)
Protein Kinases, catalytic domain 8577..8833 CDD:473864 66/264 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.