DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Unc-89 and Mag

DIOPT Version :9

Sequence 1:NP_001097440.1 Gene:Unc-89 / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:NP_058886.1 Gene:Mag / 29409 RGDID:3035 Length:626 Species:Rattus norvegicus


Alignment Length:664 Identity:132/664 - (19%)
Similarity:238/664 - (35%) Gaps:186/664 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  2060 HENCE----VIADVDADKYRLVFQSVSPCEDGKYTITA--------TNSEGRAAVDFNLAVLVEK 2112
            ||:.:    ::.|:......|:..::||...|||....        |.|| .:.:|     ::..
  Rat    82 HESFQGRSRLLGDLGLRNCTLLLSTLSPELGGKYYFRGDLGGYNQYTFSE-HSVLD-----IINT 140

  Fly  2113 PTFIVQPESQSIHDYRPVSTKVLVH-GVP------LPTIEWFKDDKPINYEAINKP---GKDKLY 2167
            |..:|.||..:       .|:|.|. .||      .|.:.|      :.:|.:.:|   |:    
  Rat   141 PNIVVPPEVVA-------GTEVEVSCMVPDNCPELRPELSW------LGHEGLGEPTVLGR---- 188

  Fly  2168 AKEDTKKGTDQIESVLDIKSFRENDVGAYTCVATNEIGVTKAPFK-LAMLSLA-PSFVKKLDNAL 2230
            .:||  :||....|:|.....||.:.....|.|.  ...|...|: .|.|.:. |..:.::::::
  Rat   189 LRED--EGTWVQVSLLHFVPTREANGHRLGCQAA--FPNTTLQFEGYASLDVKYPPVIVEMNSSV 249

  Fly  2231 DVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPNDSGAYKLI 2295
            :.::|..:.|.|..|.:|.|.:.|::||..::  |::..|      :.|::....|.:.|.|..:
  Rat   250 EAIEGSHVSLLCGADSNPPPLLTWMRDGMVLR--EAVAES------LYLDLEEVTPAEDGIYACL 306

  Fly  2296 ISNPHGE--KVALCAVAVKPEEMQPKFLKPITSQTVVV--GEPLKLEAQVTGFPAPEVKWYKDGM 2356
            ..|.:|:  :....:|...|       .||..:.|||.  ||.:.:.......|.|.:..:|:..
  Rat   307 AENAYGQDNRTVELSVMYAP-------WKPTVNGTVVAVEGETVSILCSTQSNPDPILTIFKEKQ 364

  Fly  2357 LLRPSPEINFINSPNGQIGLIIDAAQPLDAGVYKCLIANKGGEIEGVSKVEIVPKESKPVFVAEL 2421
            :|   ..:.:    ..|:.|.:.|..|.|.|.|.|:..|:.|:......:.:   |..|:.:.| 
  Rat   365 IL---ATVIY----ESQLQLELPAVTPEDDGEYWCVAENQYGQRATAFNLSV---EFAPIILLE- 418

  Fly  2422 QDASSIEGFPVKMDIKVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGL 2486
                                                  ||.|...  |....|.:.|:       
  Rat   419 --------------------------------------SHCAAAR--DTVQCLCVVKS------- 436

  Fly  2487 YEVIAQNPEGSTASKAKLYVAPKADETATEEAPQFVSA------LRDVNADEGQELVLSAPFISN 2545
                  |||.|.|     :..|..:.|..|...:||.:      |..:....||   ..||    
  Rat   437 ------NPEPSVA-----FELPSRNVTVNETEREFVYSERSGLLLTSILTLRGQ---AQAP---- 483

  Fly  2546 PMPEVIWSKDGVTLTPNERLLMTCDGKH--IGLTIKPAEAADSGNYTCLLA------------NP 2596
              |.||.:..  .|...:.|.:...|.|  :...|.|..|..:  :..|:|            |.
  Rat   484 --PRVICTSR--NLYGTQSLELPFQGAHRLMWAKIGPVGAVVA--FAILIAIVCYITQTRRKKNV 542

  Fly  2597 LGEDSSACNANVRKVYKPPVFTQKIS------DQQQVFGNNAKIPVTVSGVPYPDLEWYFQDKPI 2655
            ....|.:...|...:|.|..   :||      :.::..|:..:: :.:.|.| |:|:..:....:
  Rat   543 TESPSFSAGDNPHVLYSPEF---RISGAPDKYESEKRLGSERRL-LGLRGEP-PELDLSYSHSDL 602

  Fly  2656 ---PKSEKYSIKND 2666
               |..:.|::..:
  Rat   603 GKRPTKDSYTLTEE 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Unc-89NP_001097440.1 RhoGEF 90..260 CDD:238091
PH_unc89 275..388 CDD:270134
Atrophin-1 <493..690 CDD:331285
TonB_N 502..>596 CDD:318287
I-set 1017..1108 CDD:333254
I-set 1123..1212 CDD:254352
I-set <1236..1299 CDD:333254
I-set 1313..1403 CDD:254352
Ig_3 1406..1487 CDD:316449
I-set 1499..1595 CDD:254352
I-set 1599..1690 CDD:333254
I-set 1694..1786 CDD:254352
I-set <1836..1903 CDD:333254
I-set 1922..2005 CDD:333254
I-set 2018..2108 CDD:333254 13/59 (22%)
I-set 2113..2214 CDD:333254 26/111 (23%)
I-set 2220..2302 CDD:254352 17/81 (21%)
I-set 2318..2408 CDD:254352 21/91 (23%)
I-set 2415..2506 CDD:254352 13/90 (14%)
I-set 2519..2608 CDD:254352 21/108 (19%)
I-set 2615..2696 CDD:254352 9/61 (15%)
I-set 2717..2805 CDD:254352
FN3 2834..2925 CDD:238020
I-set <2996..3063 CDD:333254
I-set 3067..3157 CDD:333254
PK_Unc-89_rpt1 3182..3440 CDD:271011
I-set 3654..3744 CDD:333254
FN3 3748..3840 CDD:238020
STKc_Unc-89_rpt2 3893..4151 CDD:271014
MagNP_058886.1 Interaction with RTN4R and RTN4RL2. /evidence=ECO:0000269|PubMed:19420245 20..325 60/277 (22%)
IgV_CD33 22..138 CDD:409377 13/61 (21%)
Ig strand B 38..42 CDD:409377
Ig strand C 56..60 CDD:409377
Ganglioside GT1b binding. /evidence=ECO:0000250|UniProtKB:P20917 65..67
Ig strand E 100..104 CDD:409377 1/3 (33%)
Ig strand F 114..119 CDD:409377 2/4 (50%)
Ganglioside GT1b binding. /evidence=ECO:0000250|UniProtKB:P20917 124..128 0/3 (0%)
Ig strand G 128..133 CDD:409377 3/5 (60%)
IgC2_CD33_d2_like 141..235 CDD:409579 27/114 (24%)
Ig strand B 155..159 CDD:409579 2/3 (67%)
Ig strand C 171..175 CDD:409579 1/9 (11%)
Ig strand E 200..204 CDD:409579 2/3 (67%)
Ig strand F 214..219 CDD:409579 1/4 (25%)
Ig strand G 229..232 CDD:409579 0/2 (0%)
Ig_3 239..309 CDD:404760 16/77 (21%)
Ig strand A 239..242 CDD:409353 1/2 (50%)
Ig strand A' 248..251 CDD:409353 0/2 (0%)
Ig strand B 256..264 CDD:409353 2/7 (29%)
Ig strand C 270..274 CDD:409353 0/3 (0%)
Ig strand C' 277..280 CDD:409353 1/2 (50%)
Ig strand E 289..293 CDD:409353 1/3 (33%)
Ig strand F 301..309 CDD:409353 2/7 (29%)
Ig strand G 312..322 CDD:409353 1/9 (11%)
IG 333..409 CDD:214652 19/82 (23%)
Required for normal axon myelination in the central nervous system. /evidence=ECO:0000250|UniProtKB:P20917 577..626 7/42 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 581..608 5/28 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4475
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.