DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obsc and Hmcn1

DIOPT Version :10

Sequence 1:NP_001097440.1 Gene:Obsc / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:NP_001258221.1 Gene:Hmcn1 / 289094 RGDID:1564772 Length:5635 Species:Rattus norvegicus


Alignment Length:4171 Identity:888/4171 - (21%)
Similarity:1460/4171 - (35%) Gaps:1114/4171 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 IDIKPHG-PEAHLTWFN---EI--SSHINQDVTL--------QEHNADDLKVDASQIASESELIL 412
            ::.|..| |...:.||.   |:  |:.::.|..:        |:.:|.|....|:..|..:...|
  Rat   721 MECKTSGIPPPQVKWFKGDLELRPSTFLSIDPLMGLLKIQETQDLDAGDYTCVAANDAGRATGSL 785

  Fly   413 HLPQRAEAHDPNLSVR-PSDVAENYFLSKETKERLQHEQQELLKLEQ-EAIELYKKQQSSKSVSS 475
            .|    :...|.:.:: ||||:.....:......:|...:..:|..: :.:.::.|..|..|:|.
  Rat   786 TL----DVGSPPVFIQEPSDVSMEIGSNVTLPCYVQGYPEPKIKWRRLDNMPVFSKPFSVSSISQ 846

  Fly   476 -KTESVEITSSQVKSSSEVRKVVSPPPPPQAQVKEVTPVKVVSSPPPPKEITPAKVATPPPQPQV 539
             :|.::.|::..   :|:....:........:::..|.|.|.....|...|:|:|.:....||  
  Rat   847 LRTGALFISNLW---ASDKGTYICEAENQFGKIQSQTTVTVTGLVAPLIGISPSKASVIEGQP-- 906

  Fly   540 VTSPVKEVAPPPQP-------------------------------------------------RA 555
            :|.|...:|..|.|                                                 ..
  Rat   907 LTLPCTLLAGNPIPERRWMKNSAMLVQNPYITVRSDGSLHIERVRLQDGGEYTCVASNVAGTNNK 971

  Fly   556 VASPAKEVTPS-----------QSEPVKAPSPIKEVRKEVPPSASHSKEVEALVATEIRESLTET 609
            ..|.|..|.|:           :..||..|.....:.|   ||.:.||:.|.:.....:.|....
  Rat   972 TTSVAVHVLPTIQHGQQILSTIEGVPVTLPCRASGIPK---PSITWSKKGELISTGNAKFSAGAD 1033

  Fly   610 RSTVVESGQSSEIREEIVVTEESSLEGKQVVALEREPSPCSIPKIQVY-RP-VECENPVVTKHKP 672
            .|..|.|..|.|..|.|.....::...|:.|            ::.|| || |..:...:::.||
  Rat  1034 GSLYVVSPGSEESGEYICTATNAAGYAKRKV------------QLTVYVRPRVFGDQRGLSQDKP 1086

  Fly   673 IELKDIVGYSESL---------------RDGDTAPAGGSPGRQQGYSANIT--DHASLTIWNNRL 720
            :|:..:.|...:|               :|....    ||     :|...|  ...|:.|...|:
  Rat  1087 VEISVLAGEEATLPCEAKSLPPPIITWAKDSQLI----SP-----FSPRHTFLPSGSMKITETRI 1142

  Fly   721 A----------NIAGDRSGA--------------NQHLQ------------QSGPPPP------- 742
            :          ||||:.:.:              |:||:            ..|.|||       
  Rat  1143 SDSGMYLCVATNIAGNVTQSVKLSVHVPPKIQHGNRHLKVQVGQRVDIPCNAHGSPPPVITWFKS 1207

  Fly   743 --PIPPNFTRMPGFFQPLPLIAYETT--------------------IEILIVKARPPS----PPP 781
              |:|.|..:.||  .|..::..|.|                    .|:.:....||:    .||
  Rat  1208 GRPMPFNGVQHPG--SPDGMLTIEQTTLSDAGTYTCTATNIAGSDEAEVTLHVQEPPTVEDLQPP 1270

  Fly   782 ----------------------PPPPTIKRVLVHTESLEQK--TQNFFEGIYDAASSDTSLRNAK 822
                                  .|.||||.:....|...|:  .....:|.....:|.|.|.|.:
  Rat  1271 FNTPFQERLANQRMAFPCPAKGTPKPTIKWLHNGKEVTGQEPGVSILEDGALLVIASVTPLNNGE 1335

  Fly   823 QKIRSIKSTVLKSKDSTNYAQDTVQKAKARDFLHIFTPPVKK-----RPIYEIVEEPVNIF-ELE 881
            ....::           |.|..|.:|...|  :|:  |||.|     ..:..:|.:..::: |:|
  Rat  1336 YICVAV-----------NEAGTTERKYNLR--VHV--PPVIKDKEHVSNVSVLVNQLASLYCEVE 1385

  Fly   882 GDYTESI---ADDFREPSAD-------------FEARGQSVGGMDDYYSGYSRASTRRYETKTRD 930
            |..:..|   .||.:...:.             |:|..:..|       .||..:.....|..:|
  Rat  1386 GTPSPVIMWYKDDIQVTESSTVQIVNNGKILKLFKASAEDTG-------RYSCKAINIAGTSQKD 1443

  Fly   931 YD--------------------------------RGTSY---------------DSTVERSQYG- 947
            :.                                |||.:               |..:|.|..| 
  Rat  1444 FSVNVLVPPSIQGAGSPNEVSVVLNHNITLQCPVRGTPFPAIHWFKDGKPLFLGDPNIELSDRGQ 1508

  Fly   948 -ISSRRDRSSVDKVEARSSLLATGRTESRAASRAESRAES-----------RASYSVAESRAGIR 1000
             :..|..|.| ||          ||.:...::.|..:|:.           :......|..|.:.
  Rat  1509 NLHLRNARRS-DK----------GRYQCSVSNAAGKQAKDIKLTLYVPPSIKGGNVTTEISALLN 1562

  Fly  1001 SSSRLQ-EDR--PLRSV----DKPVVVKMLKSVQVEPGETAHF-EIQFKDQ-------------- 1043
            |..:|: |.|  |:.::    |..||....:::.::.|:..|. ..|..|.              
  Rat  1563 SVVKLECETRGLPVPAITWYKDGQVVTSSSQALYIDKGQFLHIPRAQVSDSATYTCHASNVAGTA 1627

  Fly  1044 ------------------------------------------PGLVTWLKDNKPLEDRLADRITQ 1066
                                                      |.::|||||..|:  :.:|.|..
  Rat  1628 EKSFHVDIYVPPIIEGDLTTPSSKQVVVGQSLVLECKAVGNPPPVLTWLKDGVPV--KASDNIHI 1690

  Fly  1067 TAAPMNSYRLDIKNCSETDAGTYTIRAQSASETTTVSAQLAVGQAP---GHDETKTNTEPAFLVS 1128
            .|   ...:|:|.:..|.|.|.|...|.|.:....:..::.|...|   |.|||.     .|:| 
  Rat  1691 EA---GGKKLEILSALEVDRGQYICVATSVAGEREIKYEVDVLVPPAVEGGDETS-----YFIV- 1746

  Fly  1129 LKDAEMIENTLFRFMVKIIGDPKPRVKFYKDEKEILETNDRIQIIRDKDYLGFYELVIADVQKTD 1193
                  :.|.|.....::.|.|.|.:.:.|. .::::..|..:|:     |...:||||..|.:|
  Rat  1747 ------LANNLLELDCQVSGSPPPTIMWLKG-GQLIDERDGFKIL-----LSGRKLVIAQAQVSD 1799

  Fly  1194 AGTYSCKATNKHGEANCEAIAT-----TVEDKN-------PFGALSGQILPAG-EKPVFQWKRNG 1245
            .|.|.|.|||..|:...|...|     |::..:       .:..:|.|.:..| ..|...|.::.
  Rat  1800 TGLYQCVATNVAGDRRKEFEVTVHVPPTIKSSDLPEKTVVRYKPVSLQCIANGIPNPSITWLKDD 1864

  Fly  1246 EEFDPEE-RFKVLFGEDEDSLALVFQHVKP--EDAGIYTCVAQTSTGNISCSAELSVQGAIQTLN 1307
            :..:... ..::      .|...|.|..|.  ||||.|||||..:.|......:|.|.       
  Rat  1865 QPVNTAPGNLRI------QSSGRVLQIAKALLEDAGRYTCVATNAAGEAHQHTQLHVH------- 1916

  Fly  1308 REPEKPTLVIEHREANASIGGSAILELQCK--GFPKPAVQWKHDGEVIQVDDRHKFMYEDEESMS 1370
               |.|:|....:..|.|:..:..::|:||  |.|.|.:.|..|...:.......|:   :....
  Rat  1917 ---EPPSLDDGGKMLNESVVVNNPIQLECKATGSPVPVLTWYKDSHPLAGSTSATFL---KRGQI 1975

  Fly  1371 LVIKNVDTVDAGVYTIEAINELGQDESSINLVVKAPPKIKKITD-ITCSAGETIKMEIEVEGFPQ 1434
            |.|.:....|||:|...|||..|..|...:|.|..||.|...:. :........::|.|..|.|.
  Rat  1976 LEIGSAQISDAGIYKCVAINSAGATELFYSLQVHVPPSISGSSSMVEVVVNNLARLECEARGIPA 2040

  Fly  1435 PTVQVTNNGKDVTAESN-VKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKATNDLSQTSEYWSC 1498
            |::....:|..|::.|| :::.|.  |:     ::.:...::|..|.|:..|.|...:....:..
  Rat  2041 PSLTWLKDGSPVSSFSNGIQVLSG--GR-----ILALTSAQMSDTGRYTCVAVNAAGEKQRDFDL 2098

  Fly  1499 TVKSKPVIVKNFESEYIHGEKENVQM----TVRI----DAYPEAKLTWYHDETEIKITDSKYTVS 1555
            .|.:.|.|:         ||::||.:    ||.:    ||.|...|.|:.|...: :.....::|
  Rat  2099 RVYAPPNIM---------GEEQNVSVLISQTVELFCQSDAVPPPTLMWFKDGRPL-LKRPGLSIS 2153

  Fly  1556 SDGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQLLIKCAPEF--THKLKNITVAEGDSNVE 1618
            .:|:  .|.|..|...|.|:||.:|||..|....:..:.|...|..  :.:|..:|..||:. :.
  Rat  2154 ENGS--VLMIEDAQAGDTGRYTCEATNVAGKTEKNYNVNIWVPPSIYGSDELVQLTAIEGNL-IT 2215

  Fly  1619 LVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQVATNMQ-GNYTCKIMNDYGKL 1682
            |:......|.|:..|...|..:........|:..|.  :.:...:|.... |.|||...|..|..
  Rat  2216 LLCESSGIPPPNLTWKKKGSLVLADAAGRVHILSGG--RRLQISIAEKADAGLYTCVASNVAGIA 2278

  Fly  1683 EDNCVVTVNCKPKVKRG---LKNVEVQEGKSFTLEVEVYSEPEAKIKWFKDGHEIYEDARIKISR 1744
            :....:.|..:|.:...   ...:.|..|:|.:||.||...|:..:.|.|||..:.:...::| .
  Rat  2279 KKEYNLQVYIRPSIANSGSHRPEITVIRGRSISLECEVQGIPQPTVTWMKDGRPLSKGKGVEI-L 2342

  Fly  1745 DTQRIENYYLTLNLARTEDAGTYEMKATNFIGETTSTCKVAVLTSEALSLEQTVTKTLIATTEEP 1809
            |..|:    |.|......|.|.|...|.|          ||.:|.:...|...|..::|.....|
  Rat  2343 DEGRV----LQLKNVHVSDTGRYVCVAVN----------VAGMTDKRYDLSVHVPPSIIGNHGVP 2393

  Fly  1810 EEGAVPEIVHVDVFQQHSYESVPLKYEVIATGIPKPEAIWYHDGKPITPDKHTAITVDGDHYKLE 1874
            |..:|.|           ..||.|..|  |:|||.|...|..||.|::......|...|  ..|.
  Rat  2394 ENISVVE-----------KSSVSLTCE--ASGIPLPSITWLKDGWPVSLGSSVKILSGG--RMLR 2443

  Fly  1875 VQSLDLVDAGEYKVVVQNKVGEKSHQGELSLSGIAEYRKPILTQGPGLKDIKVNKGDKVCEPVVF 1939
            :......|||:|..:|:|..||     :..:.|::....|.:.....|:|||:.:...|......
  Rat  2444 LMQTRPEDAGQYTCIVRNAAGE-----DRKMFGLSVLVPPHIVGDNTLEDIKIKEKQSVTLTCEV 2503

  Fly  1940 TADPAPEIVLLKDGQPVVETNNVKLKVDKKDAENGLVQYTCTLNILEAEIKDSGRYELKVKNKYG 2004
            ..:|.|:|...||||.:.|           |..:.::.....|.|..|::..:|||.....|..|
  Rat  2504 RGNPVPQITWHKDGQLLQE-----------DEVHHMMSGGRFLQITNAQVSHTGRYTCLASNIAG 2557

  Fly  2005 ELVTSGWIDVLAKPEISGLNDTKCLPGDTICF----EALV---QANPKPKVSWTRGNENLCNHEN 2062
            :...|..::|...|.|:|: |:...|.|.|..    .:||   .:.|...::|.:....|.:..|
  Rat  2558 DKSKSFSLNVFVSPTIAGV-DSDGSPEDVIVILNSPTSLVCEAYSYPPATITWFKDGAPLESSRN 2621

  Fly  2063 CEVIADVDADKYRLVFQSVSPCED--GKYTITATNSEGRAAVDFNLAV----LVEKPTFI---VQ 2118
            ..::..      ....|.::..||  |:|:..|||..|.....:.:.|    :::|...:   :.
  Rat  2622 LRILPG------GRTLQILNAQEDNAGRYSCVATNEAGEMIKHYEVKVYIPPIIKKGDLLGTGLS 2680

  Fly  2119 PESQSIHDYRPVSTKVLVHGVPLPTIEWFKDDKPINYEAINKPGKDKLYAKEDTKKGTDQIESVL 2183
            |:...|.....::.:...:.:|..::.|:||.:|:               |.|......:....|
  Rat  2681 PKEVKIRVNSSLTLECEAYAIPSASLRWYKDGQPL---------------KSDHHVNIAENGHTL 2730

  Fly  2184 DIKSFRENDVGAYTCVATNEIGVTKAPFKLAMLSLAPSFVK------KLD-----NALDVLQGEP 2237
            .||..:.:|.|.|||||:|..|..:..|.: .:.:.|||.|      .||     .|.||:...|
  Rat  2731 QIKEAQISDTGRYTCVASNLAGEDELDFDV-NIQVPPSFQKLWEIGNMLDTGRSGEAKDVIINNP 2794

  Fly  2238 LVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGE 2302
            :.|.|..:.:|.||:.|.|||..:..|:.:.|.  |.|.| |:|...:..|:|.|..:..|..||
  Rat  2795 ISLHCETNAAPPPTLTWYKDGRPLTSSDRVLIL--PGGRV-LQIPRAKVEDAGRYTCVAVNEAGE 2856

  Fly  2303 KVALCAVAVKPEEMQPKFLKPITSQ-----TVVVGEPLKLEAQVTGFPAPEVKWYKDGMLLRPSP 2362
            ......:.|    :.|..:|...|.     ||:|.:..::|...:|.|||...|.|||..|....
  Rat  2857 DSLQYDIHV----LLPPVIKGANSDLPEEVTVLVNKSAQMECSSSGSPAPRNFWQKDGQPLLEDE 2917

  Fly  2363 EINFINSPNGQIGLIIDAAQPLDAGVYKCLIANKGGEIEGVSKVEI-VPKESKPVFVAELQDASS 2426
            ...|::  :|::..|:: ||..|.|.|.|:..|..|..:....:.: ||..   |.....:..|.
  Rat  2918 HHKFLS--DGRVLQILN-AQITDTGRYVCVAENTAGSAKKYFNLNVHVPPS---VIGPNHEHLSV 2976

  Fly  2427 IEGFPVKMDIKVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIA 2491
            :....:.:..:|.|.|.|.|.|..|...|||: :::.||   ....:|.|.:....|.|.|..:|
  Rat  2977 VVNHFISLTCEVSGFPPPDLNWLKNEQPIKPN-TNVLIV---PGGRTLQIIRAKVSDGGEYTCVA 3037

  Fly  2492 QNPEGSTASKAKL--YVAPKADETATEEAPQFVSALRDVNADEGQELVLSAPFISNPMPEVIWSK 2554
            .|..|.:..|..|  :|.|...:..:|       :|..||..||..:.|.....:.|.|.:.|||
  Rat  3038 INQAGESKKKVSLTVHVPPSIKDHGSE-------SLSIVNVREGTSVSLECESNAVPPPVITWSK 3095

  Fly  2555 DGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSSACNANVRKVYKPPVFTQ 2619
            :|..:..:..:.:...|:.  |.|:.||.||:|.|.|...|..|.|....:.|   ||.||... 
  Rat  3096 NGRMIPDSSNVAILTGGQM--LHIRRAEVADTGQYVCRAINVAGRDDKNFHLN---VYVPPTIE- 3154

  Fly  2620 KISDQQQVFGNNAKIPVTV----SGVPYPDLEWYFQDKPIPKSEKYSIKNDGDHHMLIVNNCEKG 2680
              ..:.:|.......|||:    :|:|.|.:.|....|||..|:............|.:...::.
  Rat  3155 --GPETEVIVETMSNPVTLTCDATGIPPPTITWLKNHKPIENSDPLEAHILSGGSKLQIARLQRS 3217

  Fly  2681 DQGVYKCIASNREGKDITQGRLDIVNEIKKHSRSEPPVFLKKI-GDCDIYEGMVAKFTACATGYP 2744
            ::|.|.|:|||.|||......|.|        :..|.|...:: .:..:..|...:....|.|.|
  Rat  3218 NRGNYTCVASNMEGKAQKNYILSI--------QVPPSVAGAEVPSEVSVLLGENVELVCDADGIP 3274

  Fly  2745 EPEVEWFKNDQKLFPSDRFLIDIEPNGLLRLTIKNVTEYDVGRYSCRIFNPYG--DDICHAELFY 2807
            .|.::|.::.:.:...:...:.:..:| ..|.|......|:|:|:|...||.|  |.|.:..::.
  Rat  3275 IPRLQWLRDGKPIVSGETERVRVTTDG-STLNIYRALTSDMGKYTCVATNPAGEEDRIFNLNVYV 3338

  Fly  2808 -----DSLDSQQKPLEDQYTDFK-KYKKSGAPPPLSEGPIISRMTDRGLLLSW-NPSVPLTPRYP 2865
                 .:.:..:|.:....|... :.|.:|.|||               .:|| ...:||    |
  Rat  3339 PPKIRGNKEEAEKLMALVDTSLNIECKATGTPPP---------------QISWLKNGLPL----P 3384

  Fly  2866 ITYQIEMMDLPEGDWRTLRTGVRSCACDIRNLEPFRDYRFRVRVENKFGVSDPSPYTQTYRQKLV 2930
            |:..|.::               |....||          .||.:    |||.:.||.....:..
  Rat  3385 ISSHIRLL---------------SAGQAIR----------IVRAQ----VSDVAVYTCVASNRAG 3420

  Fly  2931 PDPPKTYT---YLPPGTDFRPETSPYFPKDFDIERPPHDGLAQAPQFLLREQDISYGVKDHNTEL 2992
            .| .|.|:   ::||..|....|                            ::|:. ||..:|.:
  Rat  3421 ID-SKRYSLQVFVPPNMDNAMGT----------------------------EEITL-VKGSSTSM 3455

  Fly  2993 MWFVYGYPKPKMTYYFDDMLIESGGRFDQSYTRNGQA-TLFINKMLDRDVGWYEAVATNEHGEAR 3056
            ..|..|.|.|.|::..|...:    ..|...|...|. .|.:.|....|.|.|..||:||.||..
  Rat  3456 TCFTDGAPTPSMSWLRDGQPL----ALDAHLTIGTQGMVLQLIKADTEDTGKYTCVASNEAGEVS 3516

  Fly  3057 QRVRLEIAEHPRF--LKRPDETFIMARKNGRIEAKLV--GIPLPEVHWFKDWKPIVDSSRIKISS 3117
            :...|::.|.|..  .:.|.|..::.  |..:|...:  |||.|::.|.||.:|.:.:.:::...
  Rat  3517 KHFVLKVLEPPHINGSEGPGEVSVIV--NNPLELSCIASGIPAPKISWMKDGRPFLQTEQVQTLE 3579

  Fly  3118 YDPDIYVLSIHDSIIKDGGLYSISARNIAGSISTS--VTVH-------IEENEDQYIYKTYGRHP 3173
            ...   :|.:..:.::|.|.|:..|.:.||.....  |.||       ::|.:|..:        
  Rat  3580 GGA---ILRVSSAQVEDTGRYTCLASSPAGDDDKEYLVRVHVPPNIAGVDEAQDFTV-------- 3633

  Fly  3174 YVRSKQLRYQDKYDIGDE-----LGRGTQGITYHAVERSSGDNYAAKIMYGRPELRPFMLNELEM 3233
             :|::|:..:.|.|....     |..|.|......|...||..|             ..:|..::
  Rat  3634 -LRNRQVTLECKSDAVPPPVIMWLKNGEQLQATPRVRILSGGRY-------------LQINNADL 3684

  Fly  3234 MNTFNHKNLIRPYDAYDTDRSVTLIMELAAGGELVRDNLLRRDYYTERDIAHYIRQTLWGLEHMH 3298
            .:|.|:                          ..|..|:                          
  Rat  3685 GDTANY--------------------------TCVASNI-------------------------- 3697

  Fly  3299 EMGVGHMGLTIKDLLISVVGGDIIKVSDFGLSRKINRH-NLSTLDYGMPEFVSPEVV-NKEGVNF 3361
                  .|.|.::.:::|.....|......|...:|:. .|..|..|:|   ||.:. .|:||..
  Rat  3698 ------AGKTTREFILTVNVPPSISGGPQSLVTLLNKSIALECLAEGVP---SPRITWRKDGVVL 3753

  Fly  3362 --SHDMWTVGLITYVLLGGHNPFLGIDDRETLTKIREGRWDFKDEIWTHISDDGRDFISRLLLYS 3424
              ||       ..|.:|  .|.||.|..                   .||:|.||...       
  Rat  3754 AESH-------ARYSIL--ENGFLHIQS-------------------AHITDTGRYLC------- 3783

  Fly  3425 PEERMDVKTALKHPWFFMLDRPVYDHDYQIGTDRLRNYYDHFRDWYANASCKNYFRRRRLSGCFQ 3489
                |....|                    |||                       |||:.....
  Rat  3784 ----MATNVA--------------------GTD-----------------------RRRIDLQVH 3801

  Fly  3490 HPSKMVYPPGHVYTPENTPEPL-------PEPRIRAKREEVVSKYLHPDYELGLIQSESHYQYGP 3547
            .|..:...|.:|....|....|       |:|.|..:::         .:.|.:.|:::.|:...
  Rat  3802 VPPSIAAGPTNVTVTVNVQTTLACEATGIPKPSINWRKD---------GHLLNVDQNQNSYRLLS 3857

  Fly  3548 DTYLLQLRDVNFPVRLREYMKVAHRRSPSFALNDSVDWSLPVIR---ERRRFTD--------IMD 3601
            ...|:.:                   |||  ::|:..:...|..   |.:|..|        |.|
  Rat  3858 SGSLIII-------------------SPS--VDDTASYECTVTSDAGEDKRTVDLTVQVPPTIAD 3901

  Fly  3602 EEIDDERTRSRISMYAANES-----------YSIRRLRTELGPRLDEY-TEADAMIE-------- 3646
            |.:|...||...::...:.|           ..||.|     ||.|.| ..:...||        
  Rat  3902 EPMDFLVTRQAPAVMTCSASGVPLPSIHWTKNGIRLL-----PRGDGYRILSSGAIEISAAQLNH 3961

  Fly  3647 -------------------TQREGYPPFFREKPQTIAITENQPSHIHCFAVGDPKPCVQWFKNDM 3692
                               |.|...|||.:.:|..:.:..|.|..:.|.|.|.|.|.:.|.|..:
  Rat  3962 AGRYTCIARNAAGSVHRHVTLRVQEPPFIQPQPSELDVILNNPILLPCEATGIPTPFITWQKEGI 4026

  Fly  3693 -VLTESKRIKISVDEDGRSILRFEPALHFDVGVYKVVARNKVGQTVARCRIVVATLP-------- 3748
             |:|..|  .::|...|.  |:...|:..|.|.|..||:|..|..:.:.::.|...|        
  Rat  4027 NVITSGK--SLAVLPSGS--LQISRAVQGDAGTYMCVAQNPAGTALGKIKLNVQVPPAISSHQKE 4087

  Fly  3749 -----DAPDSPEISANSGTEILLRWKQPRDDGHSTVLCYSLQYKLSNCDAWTTVADNIDHEFYLL 3808
                 |.|.|............:.|.:   |||:  |..|::.::.|..|       :...|   
  Rat  4088 YVVTMDKPVSLLCETEGSPPPDITWHK---DGHA--LTESIRQRILNSGA-------LQIAF--- 4137

  Fly  3809 HDLQPNTNYQFRLASKNRIGWSEMGIPVSASTVGGDAPKIHITKAMKHLQQLTENGHQVVP-EEE 3872
              .||:...|:...:.|..|.|.|...::...    .|:|..|:.  | ..:.||...|:| ..:
  Rat  4138 --AQPDDAGQYTCMAANMAGSSSMSTTLTVHV----PPRIQSTEV--H-YTVNENSQVVLPCVAD 4193

  Fly  3873 RVHTD-YHCEREPPNWVTDSSVSDKY-----------SFISEIARGEFSTIVK---GIQKSTDTV 3922
            .:.|. .|.||:.   |..:::..||           :.:.|.| |.::.:..   |....|.|:
  Rat  4194 GIPTPAIHWERDS---VLLANLLGKYTAQPYGELVLENVVLEDA-GTYTCVANNAAGEDTHTVTL 4254

  Fly  3923 VVAKILEVTDENEDNVVAEFDNFK---------------TLRHERIPALFSAYKPLNVPIAIFVM 3972
            .|..:...|:...|..:.:.:..:               |..:..|||.|.:....:.    .|:
  Rat  4255 TVHALPTFTELPGDLSLNKGEQLRLSCKAVGIPLPKLTWTFNNNIIPAHFDSVNGHSE----LVI 4315

  Fly  3973 EKLQGADVLTY 3983
            ||:...|..||
  Rat  4316 EKVSKEDSGTY 4326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ObscNP_001097440.1 RhoGEF 90..260 CDD:238091
PH_unc89 275..388 CDD:270134 8/31 (26%)
Not5 <477..>652 CDD:444384 40/234 (17%)
Ig 1017..1108 CDD:472250 24/147 (16%)
Ig strand B 1034..1038 CDD:409353 1/4 (25%)
Ig strand C 1046..1050 CDD:409353 1/3 (33%)
Ig strand E 1074..1078 CDD:409353 1/3 (33%)
Ig strand F 1088..1093 CDD:409353 1/4 (25%)
Ig strand G 1101..1104 CDD:409353 0/2 (0%)
I-set 1123..1212 CDD:400151 24/88 (27%)
Ig strand B 1140..1144 CDD:409353 0/3 (0%)
Ig strand C 1153..1157 CDD:409353 0/3 (0%)
Ig strand E 1182..1186 CDD:409353 1/3 (33%)
Ig strand F 1196..1201 CDD:409353 2/4 (50%)
Ig strand G 1209..1212 CDD:409353 0/2 (0%)
Ig <1236..1299 CDD:472250 17/65 (26%)
Ig strand C 1238..1242 CDD:409353 0/3 (0%)
Ig strand E 1259..1269 CDD:409353 1/9 (11%)
Ig strand F 1279..1284 CDD:409353 3/4 (75%)
Ig strand G 1292..1295 CDD:409353 0/2 (0%)
I-set 1313..1403 CDD:400151 25/91 (27%)
Ig strand B 1330..1334 CDD:409353 0/3 (0%)
Ig strand C 1343..1347 CDD:409353 0/3 (0%)
Ig strand E 1369..1373 CDD:409353 1/3 (33%)
Ig strand F 1383..1388 CDD:409353 1/4 (25%)
Ig strand G 1396..1399 CDD:409353 1/2 (50%)
Ig_3 1406..1487 CDD:464046 18/82 (22%)
I-set 1499..1595 CDD:400151 28/103 (27%)
Ig strand B 1522..1526 CDD:409353 1/7 (14%)
Ig strand C 1535..1539 CDD:409353 1/3 (33%)
Ig strand E 1561..1565 CDD:409353 1/3 (33%)
Ig strand F 1575..1580 CDD:409353 2/4 (50%)
Ig strand G 1588..1591 CDD:409353 0/2 (0%)
Ig 1599..1690 CDD:472250 19/93 (20%)
Ig strand B 1617..1621 CDD:409353 1/3 (33%)
Ig strand C 1630..1634 CDD:409353 0/3 (0%)
Ig strand E 1656..1660 CDD:409353 0/3 (0%)
Ig strand F 1670..1675 CDD:409353 3/4 (75%)
Ig strand G 1683..1686 CDD:409353 0/2 (0%)
I-set 1694..1786 CDD:400151 24/94 (26%)
Ig strand B 1711..1715 CDD:409353 1/3 (33%)
Ig strand C 1724..1728 CDD:409353 0/3 (0%)
Ig strand E 1752..1756 CDD:409353 1/3 (33%)
Ig strand F 1766..1771 CDD:409353 1/4 (25%)
Ig strand G 1779..1782 CDD:409353 0/2 (0%)
Ig <1836..1903 CDD:472250 21/66 (32%)
Ig strand C 1846..1850 CDD:409353 0/3 (0%)
Ig strand E 1871..1875 CDD:409353 1/3 (33%)
Ig strand F 1885..1890 CDD:409353 1/4 (25%)
Ig 1922..2005 CDD:472250 21/82 (26%)
Ig strand B 1933..1937 CDD:409353 1/3 (33%)
Ig strand C 1946..1950 CDD:409353 1/3 (33%)
Ig strand E 1971..1984 CDD:409353 1/12 (8%)
Ig strand F 1994..1999 CDD:409353 2/4 (50%)
Ig 2018..2108 CDD:472250 22/98 (22%)
Ig strand B 2034..2038 CDD:409353 1/7 (14%)
Ig strand C 2047..2051 CDD:409353 0/3 (0%)
Ig strand E 2074..2078 CDD:409353 0/3 (0%)
Ig strand F 2088..2093 CDD:409353 1/4 (25%)
Ig strand G 2101..2104 CDD:409353 0/2 (0%)
Ig 2113..2214 CDD:472250 22/103 (21%)
Ig strand B 2130..2134 CDD:409353 0/3 (0%)
Ig strand C 2143..2147 CDD:409353 0/3 (0%)
Ig strand E 2176..2185 CDD:409353 1/8 (13%)
Ig strand F 2195..2200 CDD:409353 3/4 (75%)
I-set 2220..2302 CDD:400151 30/92 (33%)
Ig strand B 2238..2242 CDD:409353 1/3 (33%)
Ig strand C 2251..2255 CDD:409353 1/3 (33%)
Ig strand E 2277..2281 CDD:409353 2/3 (67%)
Ig strand F 2291..2296 CDD:409353 1/4 (25%)
Ig strand G 2304..2307 CDD:409353 0/2 (0%)
I-set 2318..2408 CDD:400151 27/94 (29%)
Ig strand B 2335..2339 CDD:409353 0/3 (0%)
Ig strand C 2348..2352 CDD:409353 0/3 (0%)
Ig strand E 2374..2378 CDD:409353 0/3 (0%)
Ig strand F 2388..2393 CDD:409353 2/4 (50%)
Ig 2415..2506 CDD:472250 24/92 (26%)
Ig strand B 2432..2436 CDD:409353 0/3 (0%)
Ig strand C 2445..2449 CDD:409353 1/3 (33%)
Ig strand E 2472..2476 CDD:409353 1/3 (33%)
Ig strand F 2486..2491 CDD:409353 1/4 (25%)
Ig strand G 2499..2502 CDD:409353 0/2 (0%)
I-set 2519..2608 CDD:400151 25/88 (28%)
Ig strand B 2536..2540 CDD:409353 1/3 (33%)
Ig strand C 2549..2553 CDD:409353 0/3 (0%)
Ig strand E 2574..2578 CDD:409353 1/3 (33%)
Ig strand F 2588..2593 CDD:409353 2/4 (50%)
I-set 2615..2696 CDD:400151 22/84 (26%)
Ig strand B 2632..2636 CDD:409353 0/3 (0%)
Ig strand C 2645..2649 CDD:409353 0/3 (0%)
Ig strand E 2670..2674 CDD:409353 1/3 (33%)
Ig strand F 2684..2689 CDD:409353 2/4 (50%)
Ig strand G 2697..2700 CDD:409353 0/2 (0%)
I-set 2717..2805 CDD:400151 19/90 (21%)
Ig strand B 2734..2738 CDD:409353 0/3 (0%)
Ig strand C 2747..2751 CDD:409353 0/3 (0%)
Ig strand E 2773..2777 CDD:409353 1/3 (33%)
Ig strand F 2787..2792 CDD:409353 2/4 (50%)
Ig strand G 2800..2803 CDD:409353 1/2 (50%)
FN3 2834..2925 CDD:238020 19/91 (21%)
Ig <2996..3063 CDD:472250 20/67 (30%)
Ig strand C 3003..3007 CDD:409353 1/3 (33%)
Ig strand E 3029..3033 CDD:409353 1/4 (25%)
Ig strand F 3043..3048 CDD:409353 1/4 (25%)
Ig strand G 3056..3059 CDD:409353 0/2 (0%)
Ig 3067..3157 CDD:472250 23/102 (23%)
Ig strand B 3085..3088 CDD:409353 0/2 (0%)
Ig strand C 3097..3101 CDD:409353 0/3 (0%)
Ig strand E 3123..3127 CDD:409353 1/3 (33%)
Ig strand F 3137..3142 CDD:409353 1/4 (25%)
Ig strand G 3150..3153 CDD:409353 0/4 (0%)
PK_Unc-89_rpt1 3182..3440 CDD:271011 44/266 (17%)
Ig 3654..3744 CDD:472250 26/90 (29%)
Ig strand B 3671..3675 CDD:409353 0/3 (0%)
Ig strand C 3684..3688 CDD:409353 0/3 (0%)
Ig strand E 3710..3714 CDD:409353 1/3 (33%)
Ig strand F 3724..3729 CDD:409353 1/4 (25%)
Ig strand G 3737..3740 CDD:409353 0/2 (0%)
FN3 3748..3840 CDD:238020 20/104 (19%)
STKc_Unc-89_rpt2 3893..4151 CDD:271014 22/120 (18%)
Hmcn1NP_001258221.1 ChlD <30..210 CDD:440853
Ig 520..608 CDD:472250
Ig strand B 537..541 CDD:409353
Ig strand C 550..554 CDD:409353
Ig strand E 574..578 CDD:409353
Ig strand F 588..593 CDD:409353
Ig strand G 601..604 CDD:409353
I-set 612..696 CDD:400151
Ig strand B 629..633 CDD:409353
Ig strand C 642..646 CDD:409353
Ig strand E 665..668 CDD:409353
Ig strand F 678..683 CDD:409353
Ig strand G 693..696 CDD:409353
I-set 702..789 CDD:400151 15/71 (21%)
Ig strand B 720..723 CDD:409353 0/1 (0%)
Ig strand C 732..736 CDD:409353 0/3 (0%)
Ig strand E 755..759 CDD:409353 0/3 (0%)
Ig strand F 769..774 CDD:409353 1/4 (25%)
Ig 793..884 CDD:472250 15/93 (16%)
Ig strand B 810..814 CDD:409570 0/3 (0%)
Ig strand C 823..829 CDD:409570 1/5 (20%)
Ig strand E 850..854 CDD:409570 0/3 (0%)
Ig strand F 864..869 CDD:409570 0/4 (0%)
Ig strand G 877..880 CDD:409570 0/2 (0%)
Ig 890..977 CDD:472250 12/88 (14%)
Ig strand B 907..911 CDD:409353 1/3 (33%)
Ig strand C 921..925 CDD:409353 0/3 (0%)
Ig strand F 957..962 CDD:409353 0/4 (0%)
Ig strand G 970..973 CDD:409353 0/2 (0%)
Ig 980..1071 CDD:472250 22/105 (21%)
Ig strand B 998..1002 CDD:409353 1/3 (33%)
Ig strand C 1011..1015 CDD:409353 1/3 (33%)
Ig strand E 1035..1038 CDD:409353 1/2 (50%)
Ig strand F 1048..1053 CDD:409353 2/4 (50%)
Ig strand G 1061..1064 CDD:409353 1/2 (50%)
I-set 1085..1167 CDD:400151 17/90 (19%)
Ig strand B 1097..1101 CDD:409353 1/3 (33%)
Ig strand C 1110..1114 CDD:409353 0/3 (0%)
Ig strand E 1133..1137 CDD:409353 1/3 (33%)
Ig strand F 1147..1152 CDD:409353 0/4 (0%)
Ig strand G 1160..1163 CDD:409353 0/2 (0%)
I-set 1171..1258 CDD:400151 16/88 (18%)
Ig strand B 1188..1192 CDD:409353 0/3 (0%)
Ig strand C 1201..1205 CDD:409353 0/3 (0%)
Ig strand E 1224..1228 CDD:409353 0/3 (0%)
Ig strand F 1238..1243 CDD:409353 0/4 (0%)
Ig strand G 1251..1254 CDD:409353 0/2 (0%)
Ig 1262..1355 CDD:472250 20/105 (19%)
Ig strand B 1284..1288 CDD:409570 0/3 (0%)
Ig strand C 1297..1301 CDD:409570 3/3 (100%)
Ig strand E 1320..1324 CDD:409570 1/3 (33%)
Ig strand F 1335..1340 CDD:409570 0/4 (0%)
Ig strand G 1348..1351 CDD:409570 0/2 (0%)
I-set 1368..1448 CDD:400151 14/86 (16%)
Ig strand B 1378..1382 CDD:409353 0/3 (0%)
Ig strand C 1391..1395 CDD:409353 1/3 (33%)
Ig strand E 1414..1418 CDD:409353 0/3 (0%)
Ig strand F 1428..1433 CDD:409353 2/4 (50%)
Ig strand G 1441..1444 CDD:409353 0/2 (0%)
Ig_3 1451..1529 CDD:464046 14/88 (16%)
I-set 1563..1633 CDD:400151 12/69 (17%)
Ig strand B 1565..1569 CDD:409353 1/3 (33%)
Ig strand C 1578..1582 CDD:409353 0/3 (0%)
Ig strand E 1601..1605 CDD:409353 0/3 (0%)
Ig strand F 1615..1620 CDD:409353 0/4 (0%)
I-set 1645..1729 CDD:400151 18/88 (20%)
Ig strand B 1659..1663 CDD:409353 0/3 (0%)
Ig strand C 1672..1676 CDD:409353 1/3 (33%)
Ig strand E 1694..1699 CDD:409353 1/4 (25%)
Ig strand F 1709..1714 CDD:409353 1/4 (25%)
I-set 1752..1822 CDD:400151 21/75 (28%)
Ig strand C 1765..1769 CDD:409353 0/3 (0%)
Ig strand E 1788..1792 CDD:409353 1/3 (33%)
Ig strand F 1802..1807 CDD:409353 2/4 (50%)
IG_like 1834..1915 CDD:214653 20/86 (23%)
Ig strand B 1844..1848 CDD:409568 1/3 (33%)
Ig strand C 1857..1861 CDD:409568 0/3 (0%)
Ig strand E 1881..1885 CDD:409568 1/3 (33%)
Ig strand F 1895..1900 CDD:409568 3/4 (75%)
Ig strand G 1908..1911 CDD:409568 0/2 (0%)
Ig 1928..2000 CDD:472250 21/74 (28%)
Ig strand B 1938..1942 CDD:409353 1/3 (33%)
Ig strand C 1951..1955 CDD:409353 0/3 (0%)
Ig strand E 1974..1978 CDD:409353 1/3 (33%)
Ig strand F 1988..1993 CDD:409353 1/4 (25%)
Ig_3 2011..2087 CDD:464046 18/82 (22%)
I-set 2111..2191 CDD:400151 23/82 (28%)
Ig strand B 2121..2125 CDD:409570 1/3 (33%)
Ig strand C 2134..2138 CDD:409570 1/3 (33%)
Ig strand E 2156..2160 CDD:409570 1/5 (20%)
Ig strand F 2171..2176 CDD:409570 2/4 (50%)
Ig strand G 2184..2187 CDD:409570 0/2 (0%)
Ig_3 2194..2273 CDD:464046 17/81 (21%)
Ig_3 2297..2367 CDD:464046 21/74 (28%)
I-set 2392..2474 CDD:400151 29/101 (29%)
Ig strand B 2404..2408 CDD:409568 2/3 (67%)
Ig strand C 2417..2421 CDD:409568 0/3 (0%)
Ig strand E 2438..2444 CDD:409568 2/7 (29%)
Ig strand F 2454..2459 CDD:409568 1/4 (25%)
I-set 2478..2567 CDD:400151 24/99 (24%)
Ig strand B 2497..2501 CDD:409353 1/3 (33%)
Ig strand C 2510..2514 CDD:409353 1/3 (33%)
Ig strand E 2533..2537 CDD:409353 1/3 (33%)
Ig strand F 2547..2552 CDD:409353 2/4 (50%)
I-set 2582..2663 CDD:400151 18/86 (21%)
Ig strand B 2593..2597 CDD:409353 1/3 (33%)
Ig strand C 2606..2610 CDD:409353 0/3 (0%)
Ig strand E 2629..2633 CDD:409353 0/3 (0%)
Ig strand F 2643..2648 CDD:409353 1/4 (25%)
Ig strand G 2656..2659 CDD:409353 0/2 (0%)
I-set 2681..2762 CDD:400151 22/96 (23%)
Ig strand B 2692..2696 CDD:409353 0/3 (0%)
Ig strand C 2705..2709 CDD:409353 0/3 (0%)
Ig strand E 2727..2732 CDD:409353 1/4 (25%)
Ig strand F 2742..2747 CDD:409353 3/4 (75%)
I-set 2789..2858 CDD:400151 24/71 (34%)
Ig strand B 2795..2799 CDD:409353 1/3 (33%)
Ig strand C 2808..2812 CDD:409353 1/3 (33%)
Ig strand E 2831..2835 CDD:409353 2/4 (50%)
Ig strand F 2845..2850 CDD:409353 1/4 (25%)
I-set 2879..2960 CDD:400151 24/83 (29%)
Ig strand B 2890..2894 CDD:409353 0/3 (0%)
Ig strand C 2903..2907 CDD:409353 0/3 (0%)
Ig strand E 2925..2930 CDD:409353 1/4 (25%)
Ig strand F 2940..2945 CDD:409353 2/4 (50%)
I-set 2982..3052 CDD:400151 22/73 (30%)
Ig strand B 2982..2986 CDD:409353 0/3 (0%)
Ig strand C 2995..2999 CDD:409353 1/3 (33%)
Ig strand E 3018..3022 CDD:409353 1/3 (33%)
Ig strand F 3032..3037 CDD:409353 1/4 (25%)
I-set 3069..3147 CDD:400151 25/82 (30%)
Ig strand B 3077..3081 CDD:409353 1/3 (33%)
Ig strand C 3090..3094 CDD:409353 0/3 (0%)
Ig strand E 3113..3117 CDD:409353 1/5 (20%)
Ig strand F 3127..3132 CDD:409353 2/4 (50%)
Ig strand G 3140..3143 CDD:409353 0/2 (0%)
Ig_3 3150..3228 CDD:464046 19/80 (24%)
Ig 3244..3338 CDD:472250 20/94 (21%)
Ig strand B 3264..3268 CDD:409353 0/3 (0%)
Ig strand C 3277..3281 CDD:409353 0/3 (0%)
Ig strand E 3302..3306 CDD:409353 1/3 (33%)
Ig strand F 3316..3321 CDD:409353 2/4 (50%)
Ig strand G 3329..3332 CDD:409353 1/2 (50%)
I-set 3354..3430 CDD:400151 26/124 (21%)
Ig strand B 3360..3364 CDD:409353 0/3 (0%)
Ig strand C 3373..3377 CDD:409353 1/3 (33%)
Ig strand E 3396..3400 CDD:409353 2/13 (15%)
Ig strand F 3410..3415 CDD:409353 2/4 (50%)
Ig strand G 3423..3426 CDD:409353 1/2 (50%)
Ig 3441..3523 CDD:472250 26/114 (23%)
Ig strand B 3453..3457 CDD:409353 1/3 (33%)
Ig strand C 3466..3470 CDD:409353 1/3 (33%)
Ig strand E 3488..3493 CDD:409353 1/4 (25%)
Ig strand F 3503..3508 CDD:409353 1/4 (25%)
Ig strand G 3516..3519 CDD:409353 0/2 (0%)
Ig 3533..3606 CDD:472250 17/77 (22%)
Ig strand B 3546..3550 CDD:409353 1/3 (33%)
Ig strand C 3559..3563 CDD:409353 0/3 (0%)
Ig strand E 3581..3586 CDD:409353 1/7 (14%)
Ig strand F 3596..3601 CDD:409353 1/4 (25%)
I-set 3629..3709 CDD:400151 19/159 (12%)
Ig strand B 3639..3643 CDD:409353 0/3 (0%)
Ig strand C 3652..3656 CDD:409353 0/3 (0%)
Ig strand E 3674..3679 CDD:409353 1/17 (6%)
Ig strand F 3689..3694 CDD:409353 1/30 (3%)
Ig strand G 3702..3705 CDD:409353 0/2 (0%)
Ig_3 3712..3787 CDD:464046 26/116 (22%)
Ig 3823..3884 CDD:409353 13/90 (14%)
Ig strand C 3834..3838 CDD:409353 1/3 (33%)
Ig strand E 3859..3863 CDD:409353 1/3 (33%)
Ig strand F 3873..3878 CDD:409353 0/4 (0%)
Ig 3899..3984 CDD:472250 17/89 (19%)
Ig strand B 3914..3918 CDD:409353 0/3 (0%)
Ig strand C 3927..3931 CDD:409353 0/3 (0%)
Ig strand E 3950..3954 CDD:409353 1/3 (33%)
Ig strand F 3964..3969 CDD:409353 0/4 (0%)
Ig strand G 3977..3980 CDD:409353 0/2 (0%)
Ig_3 3987..4062 CDD:464046 25/78 (32%)
I-set 4089..4165 CDD:400151 19/92 (21%)
Ig strand B 4096..4100 CDD:409353 1/3 (33%)
Ig strand C 4109..4113 CDD:409353 0/3 (0%)
Ig strand E 4131..4135 CDD:409353 1/10 (10%)
Ig strand F 4145..4150 CDD:409353 1/4 (25%)
Ig strand G 4158..4161 CDD:409353 1/2 (50%)
Ig_3 4168..4243 CDD:464046 18/81 (22%)
I-set 4260..4345 CDD:400151 13/71 (18%)
Ig strand B 4277..4281 CDD:409353 0/3 (0%)
Ig strand C 4290..4294 CDD:409353 0/3 (0%)
Ig strand E 4311..4315 CDD:409353 0/7 (0%)
Ig strand F 4325..4330 CDD:409353 2/2 (100%)
Ig 4356..4435 CDD:472250
Ig strand B 4367..4371 CDD:409353
Ig strand C 4380..4384 CDD:409353
Ig strand E 4402..4406 CDD:409353
Ig strand F 4416..4421 CDD:409353
Ig strand G 4429..4432 CDD:409353
Ig 4441..4526 CDD:472250
Ig strand B 4457..4461 CDD:409353
Ig strand C 4470..4474 CDD:409353
Ig strand E 4492..4496 CDD:409353
Ig strand F 4506..4511 CDD:409353
Ig strand G 4519..4522 CDD:409353
TSP1 4533..4584 CDD:214559
TSP1 4589..4641 CDD:214559
TSP1 4646..4698 CDD:214559
TSP1 4703..4755 CDD:214559
TSP1 4760..4812 CDD:214559
TSP1 4817..4869 CDD:214559
G2F 4868..5092 CDD:214774
EGF_CA 5107..5146 CDD:214542
EGF_CA 5147..5174 CDD:429571
EGF_CA 5192..5229 CDD:214542
EGF_CA 5230..5263 CDD:238011
EGF_CA 5272..5303 CDD:429571
EGF_CA 5315..5354 CDD:214542
EGF_CA 5432..5471 CDD:214542
EGF_CA 5472..5508 CDD:214542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.