DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obsc and MXRA5

DIOPT Version :10

Sequence 1:NP_001097440.1 Gene:Obsc / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:NP_056234.2 Gene:MXRA5 / 25878 HGNCID:7539 Length:2828 Species:Homo sapiens


Alignment Length:3018 Identity:636/3018 - (21%)
Similarity:1008/3018 - (33%) Gaps:787/3018 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CFVRMFDSGDSPKEGWVPIDILEFNPTMSSSNG---------KESGDAEFRKL---TILRELVET 97
            |.:|.|...|:...|     ||:.....:...|         |:....|..||   |.|:..:|:
Human   223 CEMRWFLEWDAKSRG-----ILKCKKDKAYEGGQLCAMCFSPKKLYKHEIHKLKDMTCLKPSIES 282

  Fly    98 --EEEFSRDLLHVVEKYIKG-----IDKPVVPR-SVRDNKDIIFCNFLQIAEFHNNVLKEGLKCY 154
              .:..||.:....|:...|     ::|..:|: |:.          |.:.:.|.|::  .|.|.
Human   283 PLRQNRSRSIEEEQEQEEDGGSQLILEKFQLPQWSIS----------LNMTDEHGNMV--NLVCD 335

  Fly   155 SNQPNMVAKTFLR------------LERDFD------------KHVVYCQNEPL-AQDYLGSSPD 194
            ..:|..|.|..|.            :..||:            |.:.|....|: ....|..|.|
Human   336 IKKPMDVYKIHLNQTDPPDIDINATVALDFECPMTRENYEKLWKLIAYYSEVPVKLHRELMLSKD 400

  Fly   195 AKKYFQELSKQLGDDKSL------AEHLKLP---IQRINDYQL----------LFKDFIKYSLSL 240
            .:..:|  .:|..|:::|      |:.|..|   :|...|.||          |...:.:||.::
Human   401 PRVSYQ--YRQDADEEALYYTGVRAQILAEPEWVMQPSIDIQLNRRQSTAKKVLLSYYTQYSQTI 463

  Fly   241 KENVKDLERALELMLSVPSRAYDNRFLSSIEG--CR-------------------GNIYKLG--- 281
            ........|....::..||.|. .|..:.:||  |:                   |:|.|..   
Human   464 STKDTRQARGRSWVMIEPSGAV-QRDQTVLEGGPCQLSCNVKASESPSIFWVLPDGSILKAPMDD 527

  Fly   282 -----RLLLHAWCNVVDKEGKAHDRY-CFLFKSRILVTKVRKISENRSVFILQNIVKLPLCNIEL 340
                 .:|...|..:...|......| |           :.::.:.....:.:.:|:.|    ..
Human   528 PDSKFSILSSGWLRIKSMEPSDSGLYQC-----------IAQVRDEMDRMVYRVLVQSP----ST 577

  Fly   341 KADEKQIHLSLKAPEANSFLPIDIKPHGPEAHLTW-------FNEI--SSHI------------- 383
            :..||......|.|..:..||.:.... |||||:|       .|::  :||:             
Human   578 QPAEKDTVTIGKNPGESVTLPCNALAI-PEAHLSWILPNRRIINDLANTSHVYMLPNGTLSIPKV 641

  Fly   384 -------NQDVTLQEHNADDLKVDASQIASESELILHLPQRAEAHDPNLSVRPSDVAENYFLS-- 439
                   .:.|.:.:..||...|..:.....|.|.....:|..|  ..||....|:.|:...|  
Human   642 QVSDSGYYRCVAVNQQGADHFTVGITVTKKGSGLPSKRGRRPGA--KALSRVREDIVEDEGGSGM 704

  Fly   440 ---KETKERLQH--EQQELLKLEQEAIELYKKQQSSK------SVSSKTESVEITSSQVKSSSEV 493
               :.|..||.|  :|:..||.:.:||...||.:..:      ..|.|.....:        :|.
Human   705 GDEENTSRRLLHPKDQEVFLKTKDDAINGDKKAKKGRRKLKLWKHSEKEPETNV--------AEG 761

  Fly   494 RKVVSPPPPPQAQVKEVTPVKVV--------SSPPPPKEITP-AKVATPPPQPQVVTSPVKEVAP 549
            |:|...........|::.|.:..        .:.|...|:.| .|..:||.....||.|...::|
Human   762 RRVFESRRRINMANKQINPERWADILAKVRGKNLPKGTEVPPLIKTTSPPSLSLEVTPPFPAISP 826

  Fly   550 PPQPRAVASPAKEVTPSQSEPVKAPSPIKEVRKEVPPSAS-------HSKEVEALVATEIRESLT 607
            |.     |||.:.||  .:|...|..|:....:.|..:.|       |:.....||..|:..:..
Human   827 PS-----ASPVQTVT--SAEESSADVPLLGEEEHVLGTISSASMGLEHNHNGVILVEPEVTSTPL 884

  Fly   608 ETRSTVVESGQSSEIREEIVVTEESSLEGKQVVALEREPSPCSIPKIQVYRPVECENPVVTKH-K 671
            |   .||:  ..||..|||..| |..|:|.....|..||          |.|....:.:.|.: |
Human   885 E---EVVD--DLSEKTEEITST-EGDLKGTAAPTLISEP----------YEPSPTLHTLDTVYEK 933

  Fly   672 PIELKDIVGYSESLRDG-DTAPAGGSPGRQQGYSANITDHASLTIWNNRLANIAGDRSGANQHLQ 735
            |.       :.|:..:| ..|..|.||...........|..||.                     
Human   934 PT-------HEETATEGWSAADVGSSPEPTSSEYEPPLDAVSLA--------------------- 970

  Fly   736 QSGPPPPPIPPNFTRMPGFFQPLPLIAYETTIEILIVKARPPSPPP--------PPPPTIKRVLV 792
            :|.|..            :|.|           .|..|::|.....        .|.|||   .|
Human   971 ESEPMQ------------YFDP-----------DLETKSQPDEDKMKEDTFAHLTPTPTI---WV 1009

  Fly   793 HTESLEQKTQNFFEGIYDAASSDTSLRNAKQKIRSIKSTVLKSKDSTNYAQDTVQKAKARDFLHI 857
            :..|..|..::...| .......:.|:.....|..:||::     ||   |||:           
Human  1010 NDSSTSQLFEDSTIG-EPGVPGQSHLQGLTDNIHLVKSSL-----ST---QDTL----------- 1054

  Fly   858 FTPPVKKRPIYEIVEEPVNIFELEGDYTESIADDFREPSADFEARGQSVGGMDDYYSGYSRASTR 922
                :.|:.:.|:.:.......||||.|.|.:.         |:.||                  
Human  1055 ----LIKKGMKEMSQTLQGGNMLEGDPTHSRSS---------ESEGQ------------------ 1088

  Fly   923 RYETKTRDYDRGTSYDSTVERSQYGISSRRDRSSVDKVEARS--SLLATGRTESRAASRAESRAE 985
              |:|:.     |..|||:     ||.|  ..|.|.|....:  :||....|.:....|.:....
Human  1089 --ESKSI-----TLPDSTL-----GIMS--SMSPVKKPAETTVGTLLDKDTTTATTTPRQKVAPS 1139

  Fly   986 SRASYSVAESRAGIRSSSRLQEDRPLRSVDKPVVVKMLKSVQVEPGETAHFEIQFKDQPGLV--T 1048
            |..|...:..|...|...|..:.|.......|......::...:|.:....:|..:.:..||  .
Human  1140 STMSTHPSRRRPNGRRRLRPNKFRHRHKQTPPTTFAPSETFSTQPTQAPDIKISSQVESSLVPTA 1204

  Fly  1049 WLKDN-----KPLEDRLADRITQTAAPMNSYRLDIKNCSETDAGT-------------YTIRAQS 1095
            |: ||     |.||..                   ||...|..||             ||     
Human  1205 WV-DNTVNTPKQLEME-------------------KNAEPTSKGTPRRKHGKRPNKHRYT----- 1244

  Fly  1096 ASETTTVSAQLAVGQAPG------HDETKTNTEPAFL----VSLKDAEMIENTLFRFMVKIIGDP 1150
               .:|||:: |.|..|.      |....|.:....|    ||||.....::..:....:.|...
Human  1245 ---PSTVSSR-ASGSKPSPSPENKHRNIVTPSSETILLPRTVSLKTEGPYDSLDYMTTTRKIYSS 1305

  Fly  1151 KPRVK-----FYK---DEKEILETNDRIQIIRDKDYLGFYELVIADVQKTDAGTYSCKATN--KH 1205
            .|:|:     .||   |.|||            ||          ||           |||  ||
Human  1306 YPKVQETLPVTYKPTSDGKEI------------KD----------DV-----------ATNVDKH 1337

  Fly  1206 -------GEANCEAIATTVEDKNPFGALSGQILPAGEKPVFQWK-----------------RNGE 1246
                   ||:...||.|:....:..|....:..|.|......|.                 .:||
Human  1338 KSDILVTGESITNAIPTSRSLVSTMGEFKEESSPVGFPGTPTWNPSRTAQPGRLQTGIPVTTSGE 1402

  Fly  1247 EFDPEERFKVLFGEDED------SLALVFQHVKPEDAGIYTCVAQTSTGNISCSAE--------L 1297
            ........|.|  ||.|      |...|......|:||..|.::.......|..||        |
Human  1403 NLTDPPLLKEL--EDVDFTSEFLSSLTVSTPFHQEEAGSSTTLSSIKVEVASSQAETTTLDQDHL 1465

  Fly  1298 SVQGAIQTLNREPEKPTLVIEHREANASIGGSAIL-ELQCKGFPKPAVQWKHDGEVIQVDDRHKF 1361
            ....||......|:..|......:..||...|.|| .|......|||:......:..:....:.|
Human  1466 ETTVAILLSETRPQNHTPTAARMKEPASSSPSTILMSLGQTTTTKPALPSPRISQASRDSKENVF 1530

  Fly  1362 M--YEDEESMSLVIKNVDTVDAGVYTIEAINEL---GQDESSINLVVKAPPKIKKITDITCSAGE 1421
            :  ..:.|:.:..:.|     .|...:...|||   ..|:.:.||                    
Human  1531 LNYVGNPETEATPVNN-----EGTQHMSGPNELSTPSSDQDAFNL-------------------- 1570

  Fly  1422 TIKMEIEVEGF-----PQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNY 1481
            :.|:|:|.:.|     |:.......:|:...:....::.:..|   |....|.:.|:....|..|
Human  1571 STKLELEKQVFGSRSLPRGPDSQRQDGRVHASHQLTRVPAKPI---LPTATVRLPEMSTQSASRY 1632

  Fly  1482 SIKATNDLSQTSEYWSCTVKSKPVIVKNFESEYIHGE-KENVQMTVRIDAYPEAKLTWYHDETEI 1545
            .:     .||:..:|:    :||.|     :.|..|. .||.|.|....:.....|..:..:..|
Human  1633 FV-----TSQSPRHWT----NKPEI-----TTYPSGALPENKQFTTPRLSSTTIPLPLHMSKPSI 1683

  Fly  1546 --KITDSKYTVSSDGNAYTLKITGATRVDAGKYTV-KATNEHGSATSSTQLLIKCAPEFTHKLKN 1607
              |.||.:   :...|.|: |:.|...:...:..| |..:......|:.:|     |.||:|   
Human  1684 PSKFTDRR---TDQFNGYS-KVFGNNNIPEARNPVGKPPSPRIPHYSNGRL-----PFFTNK--- 1736

  Fly  1608 ITVAEGDSNVELVVGVDAYPRPHAKWYIDGIEIDEKR---NDFRHVEEGNDFKLIMNQVA----- 1664
             |::.....|.....:...|.|..:         |::   ..:..:...:.|.|.....|     
Human  1737 -TLSFPQLGVTRRPQIPTSPAPVMR---------ERKVIPGSYNRIHSHSTFHLDFGPPAPPLLH 1791

  Fly  1665 ---------TNMQG-----------NYTCKIMNDYGKLEDNC------------VVTVNCKPKV- 1696
                     ||:|.           ::....:...|....:.            ..::..||:: 
Human  1792 TPQTTGSPSTNLQNIPMVSSTQSSISFITSSVQSSGSFHQSSSKFFAGGPPASKFWSLGEKPQIL 1856

  Fly  1697 KRGLKNVEVQEGKSFTLEVEVYSEPEAKIKWFK--DGHEIYEDARIKISRDTQRIE---NYYLTL 1756
            .:..:.|.|..........|...:|:..:.|.|  .|..:..:.||      ||.|   |..|.:
Human  1857 TKSPQTVSVTAETDTVFPCEATGKPKPFVTWTKVSTGALMTPNTRI------QRFEVLKNGTLVI 1915

  Fly  1757 NLARTEDAGTYEMKATNFIGETTSTCKVAVLTSEALSLEQTVTKTLIATTEEPEEGAVPEIVHVD 1821
            ...:.:|.|.|...|:|..|                 |::.|. .|..|.::|:           
Human  1916 RKVQVQDRGQYMCTASNLHG-----------------LDRMVV-LLSVTVQQPQ----------- 1951

  Fly  1822 VFQQHSYESV------PLKYEVIATGIPKPEAIWYHDGKPITPDK---HTAITVDG-----DHYK 1872
            :...| |:.|      .:..|.:|.|.|.|:..|      |.||:   .|...|:|     ::..
Human  1952 ILASH-YQDVTVYLGDTIAMECLAKGTPAPQISW------IFPDRRVWQTVSPVEGRITLHENRT 2009

  Fly  1873 LEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSLSGIAEYRKPILTQGPGLKDIKVNKGDKVCEPV 1937
            |.::.....|.|.||.|..|..|..|....|.::.:    .|::.| ..|::|.:..|..:....
Human  2010 LSIKEASFSDRGVYKCVASNAAGADSLAIRLHVAAL----PPVIHQ-EKLENISLPPGLSIHIHC 2069

  Fly  1938 VFTADPAPEI-VLLKDGQPVVETNNVKLKVDKKDAENGLVQYTCTLNILEAEIKDSGRYELKVKN 2001
            ...|.|.|.: .:|.||        .:::..:....|..|....||.|.....|||||||....|
Human  2070 TAKAAPLPSVRWVLGDG--------TQIRPSQFLHGNLFVFPNGTLYIRNLAPKDSGRYECVAAN 2126

  Fly  2002 KYGELVTSGWIDV---LAKPEISGLND--TKCLPGDTICFEALVQANPKPKVSWTRGNENLCN-- 2059
            ..|....:..::|   .|...|:|.:.  |....|.|:..:.....:|.|::.|...::.:.:  
Human  2127 LVGSARRTVQLNVQRAAANARITGTSPRRTDVRYGGTLKLDCSASGDPWPRILWRLPSKRMIDAL 2191

  Fly  2060 ---HENCEVIADVDADKYRLVFQSVSPCEDGKYTITATNSEGRAAVDFNLAVLVEKPTFIVQPES 2121
               ....:|.|:     ..||.:||:..:.|.|...|.|..|...|...:.| |.||..|...|.
Human  2192 FSFDSRIKVFAN-----GTLVVKSVTDKDAGDYLCVARNKVGDDYVVLKVDV-VMKPAKIEHKEE 2250

  Fly  2122 QSIHDYRPVSTKV--LVHGVPLPTIEW-FKDDKPIN--YEAINKPGKDKLYAKEDTKKGTDQIES 2181
            .....:.....||  :..|:|.|.|.| ..|...:|  .::.:..|:.|.|..  ...||.....
Human  2251 NDHKVFYGGDLKVDCVATGLPNPEISWSLPDGSLVNSFMQSDDSGGRTKRYVV--FNNGTLYFNE 2313

  Fly  2182 VLDIKSFRENDVGAYTCVATNEIGVTKAPFKLAMLSLAPSFVKKLDNALDVLQGEPLVLECCVDG 2246
            |    ..||.  |.|||.|.|::|..:...::.:::...:...|...|:.|..|:.:.:.|...|
Human  2314 V----GMREE--GDYTCFAENQVGKDEMRVRVKVVTAPATIRNKTYLAVQVPYGDVVTVACEAKG 2372

  Fly  2247 SPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGE--KVALCAV 2309
            .|:|.|.||...::|.|:.|.|.....||  .|.|...|.:|||.|..::.|..||  |.....|
Human  2373 EPMPKVTWLSPTNKVIPTSSEKYQIYQDG--TLLIQKAQRSDSGNYTCLVRNSAGEDRKTVWIHV 2435

  Fly  2310 AVKPEEMQPKF---LKPITS-QTVVVGEPLKL-EAQVTGFPAPEVKW-YKDGMLLRPSPEINFIN 2368
            .|:|    ||.   ..|||: :.:..|...|| :.:..|.|.|.|.| :.:|::| |:|......
Human  2436 NVQP----PKINGNPNPITTVREIAAGGSRKLIDCKAEGIPTPRVLWAFPEGVVL-PAPYYGNRI 2495

  Fly  2369 SPNGQIGLIIDAAQPLDAGVYKCLIANKGGEIEGVSKVEIVPKESKPVFVAELQD-ASSIEGFPV 2432
            :.:|...|.|.:.:..|:....|:..|:|||...:.::.::....||:|...:.: .:::.|..:
Human  2496 TVHGNGSLDIRSLRKSDSVQLVCMARNEGGEARLILQLTVLEPMEKPIFHDPISEKITAMAGHTI 2560

  Fly  2433 KMDIKVVGNPKPKLQW-FHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEG 2496
            .::....|.|.|.|.| ..||.:::............|  ..|.|...:..|:|.|..:|:|..|
Human  2561 SLNCSAAGTPTPSLVWVLPNGTDLQSGQQLQRFYHKAD--GMLHISGLSSVDAGAYRCVARNAAG 2623

  Fly  2497 STASKAKLYVAPKADETATEEAPQFVSALRDVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTP 2561
            .|.....|.|..|.:  |.::....||.:      .|:.|.|.............|:      .|
Human  2624 HTERLVSLKVGLKPE--ANKQYHNLVSII------NGETLKLPCTPPGAGQGRFSWT------LP 2674

  Fly  2562 NERLLMTCDGKHI---------------GLTIKPAEAADSGNYTCLLANPLGEDSSACNANVRKV 2611
            |        |.|:               .||::.|...|.|.|.|.:....|  .|..:..|..:
Human  2675 N--------GMHLEGPQTLGRVSLLDNGTLTVREASVFDRGTYVCRMETEYG--PSVTSIPVIVI 2729

  Fly  2612 YKPPVFTQKISDQQQVF----GNNAKIPVTVSGVPYPDLEWYFQDKPIPK----SEKYSIKNDGD 2668
            ..||..|   |:...|.    ||..|:.....|:|..|:.|...||...|    :..|..:....
Human  2730 AYPPRIT---SEPTPVIYTRPGNTVKLNCMAMGIPKADITWELPDKSHLKAGVQARLYGNRFLHP 2791

  Fly  2669 HHMLIVNNCEKGDQGVYKCIASNREGKD 2696
            ...|.:.:..:.|.|.|||:|.|..|.|
Human  2792 QGSLTIQHATQRDAGFYKCMAKNILGSD 2819

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ObscNP_001097440.1 RhoGEF 90..260 CDD:238091 42/221 (19%)
PH_unc89 275..388 CDD:270134 25/150 (17%)
Not5 <477..>652 CDD:444384 45/190 (24%)
Ig 1017..1108 CDD:472250 21/110 (19%)
Ig strand B 1034..1038 CDD:409353 0/3 (0%)
Ig strand C 1046..1050 CDD:409353 2/5 (40%)
Ig strand E 1074..1078 CDD:409353 0/3 (0%)
Ig strand F 1088..1093 CDD:409353 3/17 (18%)
Ig strand G 1101..1104 CDD:409353 2/2 (100%)
I-set 1123..1212 CDD:400151 25/109 (23%)
Ig strand B 1140..1144 CDD:409353 0/3 (0%)
Ig strand C 1153..1157 CDD:409353 1/8 (13%)
Ig strand E 1182..1186 CDD:409353 0/3 (0%)
Ig strand F 1196..1201 CDD:409353 0/4 (0%)
Ig strand G 1209..1212 CDD:409353 0/2 (0%)
Ig <1236..1299 CDD:472250 18/93 (19%)
Ig strand C 1238..1242 CDD:409353 0/3 (0%)
Ig strand E 1259..1269 CDD:409353 4/15 (27%)
Ig strand F 1279..1284 CDD:409353 1/4 (25%)
Ig strand G 1292..1295 CDD:409353 1/2 (50%)
I-set 1313..1403 CDD:400151 20/95 (21%)
Ig strand B 1330..1334 CDD:409353 2/4 (50%)
Ig strand C 1343..1347 CDD:409353 1/3 (33%)
Ig strand E 1369..1373 CDD:409353 0/3 (0%)
Ig strand F 1383..1388 CDD:409353 0/4 (0%)
Ig strand G 1396..1399 CDD:409353 0/2 (0%)
Ig_3 1406..1487 CDD:464046 12/85 (14%)
I-set 1499..1595 CDD:400151 22/99 (22%)
Ig strand B 1522..1526 CDD:409353 1/3 (33%)
Ig strand C 1535..1539 CDD:409353 1/3 (33%)
Ig strand E 1561..1565 CDD:409353 1/3 (33%)
Ig strand F 1575..1580 CDD:409353 1/5 (20%)
Ig strand G 1588..1591 CDD:409353 1/2 (50%)
Ig 1599..1690 CDD:472250 16/130 (12%)
Ig strand B 1617..1621 CDD:409353 1/3 (33%)
Ig strand C 1630..1634 CDD:409353 0/3 (0%)
Ig strand E 1656..1660 CDD:409353 2/3 (67%)
Ig strand F 1670..1675 CDD:409353 0/4 (0%)
Ig strand G 1683..1686 CDD:409353 0/2 (0%)
I-set 1694..1786 CDD:400151 21/97 (22%)
Ig strand B 1711..1715 CDD:409353 0/3 (0%)
Ig strand C 1724..1728 CDD:409353 0/3 (0%)
Ig strand E 1752..1756 CDD:409353 1/3 (33%)
Ig strand F 1766..1771 CDD:409353 1/4 (25%)
Ig strand G 1779..1782 CDD:409353 0/2 (0%)
Ig <1836..1903 CDD:472250 21/74 (28%)
Ig strand C 1846..1850 CDD:409353 0/3 (0%)
Ig strand E 1871..1875 CDD:409353 1/3 (33%)
Ig strand F 1885..1890 CDD:409353 2/4 (50%)
Ig 1922..2005 CDD:472250 22/83 (27%)
Ig strand B 1933..1937 CDD:409353 0/3 (0%)
Ig strand C 1946..1950 CDD:409353 0/4 (0%)
Ig strand E 1971..1984 CDD:409353 4/12 (33%)
Ig strand F 1994..1999 CDD:409353 3/4 (75%)
Ig 2018..2108 CDD:472250 20/96 (21%)
Ig strand B 2034..2038 CDD:409353 0/3 (0%)
Ig strand C 2047..2051 CDD:409353 0/3 (0%)
Ig strand E 2074..2078 CDD:409353 1/3 (33%)
Ig strand F 2088..2093 CDD:409353 1/4 (25%)
Ig strand G 2101..2104 CDD:409353 1/2 (50%)
Ig 2113..2214 CDD:472250 27/105 (26%)
Ig strand B 2130..2134 CDD:409353 0/3 (0%)
Ig strand C 2143..2147 CDD:409353 2/4 (50%)
Ig strand E 2176..2185 CDD:409353 2/8 (25%)
Ig strand F 2195..2200 CDD:409353 3/4 (75%)
I-set 2220..2302 CDD:400151 25/81 (31%)
Ig strand B 2238..2242 CDD:409353 0/3 (0%)
Ig strand C 2251..2255 CDD:409353 1/3 (33%)
Ig strand E 2277..2281 CDD:409353 1/3 (33%)
Ig strand F 2291..2296 CDD:409353 1/4 (25%)
Ig strand G 2304..2307 CDD:409353 0/2 (0%)
I-set 2318..2408 CDD:400151 26/95 (27%)
Ig strand B 2335..2339 CDD:409353 2/4 (50%)
Ig strand C 2348..2352 CDD:409353 2/4 (50%)
Ig strand E 2374..2378 CDD:409353 1/3 (33%)
Ig strand F 2388..2393 CDD:409353 1/4 (25%)
Ig 2415..2506 CDD:472250 21/92 (23%)
Ig strand B 2432..2436 CDD:409353 0/3 (0%)
Ig strand C 2445..2449 CDD:409353 2/4 (50%)
Ig strand E 2472..2476 CDD:409353 1/3 (33%)
Ig strand F 2486..2491 CDD:409353 1/4 (25%)
Ig strand G 2499..2502 CDD:409353 0/2 (0%)
I-set 2519..2608 CDD:400151 19/103 (18%)
Ig strand B 2536..2540 CDD:409353 2/3 (67%)
Ig strand C 2549..2553 CDD:409353 0/3 (0%)
Ig strand E 2574..2578 CDD:409353 1/18 (6%)
Ig strand F 2588..2593 CDD:409353 2/4 (50%)
I-set 2615..2696 CDD:400151 24/88 (27%)
Ig strand B 2632..2636 CDD:409353 1/3 (33%)
Ig strand C 2645..2649 CDD:409353 1/3 (33%)
Ig strand E 2670..2674 CDD:409353 1/3 (33%)
Ig strand F 2684..2689 CDD:409353 3/4 (75%)
Ig strand G 2697..2700 CDD:409353 636/3018 (21%)
I-set 2717..2805 CDD:400151
Ig strand B 2734..2738 CDD:409353
Ig strand C 2747..2751 CDD:409353
Ig strand E 2773..2777 CDD:409353
Ig strand F 2787..2792 CDD:409353
Ig strand G 2800..2803 CDD:409353
FN3 2834..2925 CDD:238020
Ig <2996..3063 CDD:472250
Ig strand C 3003..3007 CDD:409353
Ig strand E 3029..3033 CDD:409353
Ig strand F 3043..3048 CDD:409353
Ig strand G 3056..3059 CDD:409353
Ig 3067..3157 CDD:472250
Ig strand B 3085..3088 CDD:409353
Ig strand C 3097..3101 CDD:409353
Ig strand E 3123..3127 CDD:409353
Ig strand F 3137..3142 CDD:409353
Ig strand G 3150..3153 CDD:409353
PK_Unc-89_rpt1 3182..3440 CDD:271011
Ig 3654..3744 CDD:472250
Ig strand B 3671..3675 CDD:409353
Ig strand C 3684..3688 CDD:409353
Ig strand E 3710..3714 CDD:409353
Ig strand F 3724..3729 CDD:409353
Ig strand G 3737..3740 CDD:409353
FN3 3748..3840 CDD:238020
STKc_Unc-89_rpt2 3893..4151 CDD:271014
MXRA5NP_056234.2 leucine-rich repeat 38..55 CDD:275380
LRR <46..>218 CDD:443914
LRR 1 56..77
leucine-rich repeat 57..80 CDD:275380
LRR 2 80..101
leucine-rich repeat 81..104 CDD:275380
LRR 3 104..125
leucine-rich repeat 105..128 CDD:275380
LRR 4 128..149
leucine-rich repeat 129..152 CDD:275380
LRR 5 152..173
leucine-rich repeat 153..184 CDD:275380
LRR 6 184..205
leucine-rich repeat 185..208 CDD:275380
LRRCT 217..>263 CDD:214507 9/44 (20%)
IG_like 486..572 CDD:214653 12/96 (13%)
Ig strand B 497..501 CDD:409353 1/3 (33%)
Ig strand C 510..515 CDD:409353 0/4 (0%)
Ig strand E 538..542 CDD:409353 1/3 (33%)
Ig strand F 552..557 CDD:409353 2/15 (13%)
IG_like 590..668 CDD:214653 16/78 (21%)
Ig strand B 595..599 CDD:409353 1/3 (33%)
Ig strand C 608..612 CDD:409353 2/3 (67%)
Ig strand E 634..638 CDD:409353 0/3 (0%)
Ig strand F 648..653 CDD:409353 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 671..715 11/45 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 933..962 8/35 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1068..1190 33/162 (20%)
DUF5585 1181..>1561 CDD:465521 94/448 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1204..1275 21/99 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1367..1389 3/21 (14%)
LRR 7 1410..1434 7/25 (28%)
PHA03247 <1465..1799 CDD:223021 73/397 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1479..1499 4/19 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1536..1566 7/34 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1579..1603 3/23 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1669..1689 3/19 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1700..1719 4/18 (22%)
Ig_3 1852..1932 CDD:464046 20/85 (24%)
Ig 1958..2042 CDD:472250 23/89 (26%)
Ig strand B 1968..1972 CDD:409353 0/3 (0%)
Ig strand C 1981..1985 CDD:409353 1/9 (11%)
Ig strand E 2008..2012 CDD:409353 1/3 (33%)
Ig strand F 2022..2027 CDD:409353 2/4 (50%)
Ig strand G 2035..2038 CDD:409353 1/2 (50%)
Ig 2065..2137 CDD:472250 20/79 (25%)
Ig strand B 2065..2069 CDD:409353 0/3 (0%)
Ig strand C 2078..2082 CDD:409353 0/3 (0%)
Ig strand E 2105..2109 CDD:409353 2/3 (67%)
Ig strand F 2119..2124 CDD:409353 3/4 (75%)
Ig strand G 2133..2136 CDD:409353 0/2 (0%)
Ig_3 2147..2225 CDD:464046 17/82 (21%)
IG_like 2258..2341 CDD:214653 24/90 (27%)
Ig strand C 2274..2278 CDD:409353 1/3 (33%)
Ig strand E 2307..2311 CDD:409353 2/3 (67%)
Ig strand F 2321..2326 CDD:409353 3/4 (75%)
Ig 2356..2431 CDD:472250 26/76 (34%)
Ig strand B 2364..2368 CDD:409353 0/3 (0%)
Ig strand C 2377..2381 CDD:409353 1/3 (33%)
Ig strand E 2401..2405 CDD:409353 2/5 (40%)
Ig strand F 2415..2420 CDD:409353 1/4 (25%)
Ig strand G 2428..2431 CDD:409353 1/2 (50%)
Ig 2457..2535 CDD:472250 21/78 (27%)
Ig strand B 2462..2466 CDD:409353 2/3 (67%)
Ig strand C 2475..2480 CDD:409353 2/4 (50%)
Ig strand E 2501..2505 CDD:409353 1/3 (33%)
Ig strand F 2515..2520 CDD:409353 1/4 (25%)
Ig strand G 2528..2531 CDD:409353 0/2 (0%)
IG_like 2549..2633 CDD:214653 19/85 (22%)
Ig strand B 2560..2564 CDD:409568 0/3 (0%)
Ig strand C 2573..2577 CDD:409568 1/3 (33%)
Ig strand E 2599..2603 CDD:409568 1/3 (33%)
Ig strand F 2613..2618 CDD:409568 1/4 (25%)
Ig strand G 2626..2629 CDD:409568 0/2 (0%)
IG_like 2652..2728 CDD:214653 18/91 (20%)
Ig strand B 2655..2659 CDD:409353 2/3 (67%)
Ig strand C 2668..2672 CDD:409353 0/3 (0%)
Ig strand E 2694..2698 CDD:409353 1/3 (33%)
Ig strand F 2708..2713 CDD:409353 2/4 (50%)
Ig_3 2732..2814 CDD:464046 23/84 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.