DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obsc and HMCN2

DIOPT Version :10

Sequence 1:NP_001097440.1 Gene:Obsc / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:NP_001278744.1 Gene:HMCN2 / 256158 HGNCID:21293 Length:5079 Species:Homo sapiens


Alignment Length:4249 Identity:894/4249 - (21%)
Similarity:1454/4249 - (34%) Gaps:1104/4249 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 ERALELMLSVPSRAYDNRF------LSSIEGCRGNIYKLGRLLLHAWCNVVDKEGKAHDRYCFLF 306
            :..|.::|::|..|....|      |.||:     :|..||   |:                   
Human   268 DEGLNVLLNIPDSAKVVAFKPEHPGLWSIK-----VYSSGR---HS------------------- 305

  Fly   307 KSRILVTKVRKISENRSVFILQNIVKL------PLCNIE---------LKADEKQIHLSLKAPEA 356
               :.:|.|..| :.|:.|..|.::.|      ||..:.         |||..:...:.|.....
Human   306 ---VRITGVSNI-DFRAGFSTQPLLDLNHTLEWPLQGVPISLVINSTGLKAPGRLDSVELAQSSG 366

  Fly   357 NSFLPIDIKP-HGPEAHLTW----FNEISSHINQDVTLQEHNADDL----KVDASQIASESELIL 412
            ...|.:..|| .....|..|    |:.........|..::|..:.|    .|..|.:|..:.|:.
Human   367 KPLLTLPTKPLSNGSTHQLWGGPPFHTPKERFYLKVKGKDHEGNPLLRVSGVSYSGVAPGAPLVS 431

  Fly   413 HLPQ-RAEAHDPNLSVRPSDVAENYFLSKETKERLQHEQQELLKLEQEAIELYKKQQSSKSVSSK 476
            ..|: ....|.|.|.......|..:.|.....|....|::...:....:.|:.:        :||
Human   432 MAPRIHGYLHQPLLVSCSVHSALPFRLQLRRGEARLGEERHFQESGNSSWEILR--------ASK 488

  Fly   477 TE--SVEITS-SQVKSSSEVRKVVSPPPPPQAQVKEVTPVKVVSSPPPPKEITPAKVATPPP--- 535
            .|  :.|.|: |:..:.....::|...||||     :.|...|:..|....:...:|....|   
Human   489 AEEGTYECTAVSRAGTGRAKAQIVVTDPPPQ-----LVPAPNVTVSPGETAVLSCRVLGEAPYNL 548

  Fly   536 -----------------QPQVVTSPVKEVAPPPQPR--AVASPAKEVT-----------PSQSEP 570
                             |...::..:..:.|....|  .|||.|..||           |..|..
Human   549 TWVRDWRVLPASTGRVAQLADLSLEISGIIPTDGGRYQCVASNANGVTRASVWLLVREAPQVSIH 613

  Fly   571 VKAPSPIKEVRKEVPPSAS-----H---SKEVEALVATEIRESLTETRSTVVESGQSSEI--REE 625
            ..:....:.|..:|..|||     |   |:|.:||  .|......:.:.|::..|.:.|.  ...
Human   614 TSSQHFSQGVEVKVSCSASGYPTPHISWSRESQAL--QEDSRIHVDAQGTLIIQGVAPEDAGNYS 676

  Fly   626 IVVTEESSLEGKQVVALEREPSPCSIPKIQVYRPVECENPVVTKHKPIELKDIVGYSESLRDGDT 690
            ...|.|...:.:.|.....:|...|.....|...|..|..:|.:...:....::.|...| :...
Human   677 CQATNEVGTDQETVTLYYTDPPSVSAVNAVVLVAVGEEAVLVCEASGVPPPRVIWYRGGL-EMIL 740

  Fly   691 APAGGSPGRQQGYSANITDHASLTIWNNRLANIAGDRSGANQ----HLQQSGPPPPPIPPNFTRM 751
            ||.|.|.|:.:..:|...|..:.|.   |..|..||.|...|    |           .|..|.:
Human   741 APEGSSSGKLRIPAAQERDAGTYTC---RAVNELGDASAEIQLAVGH-----------APQLTEL 791

  Fly   752 PGFFQPLPLIAYETTIEI---LIVKARPPSPPPPP--------PPTIKRVLVHTESLEQKTQN-- 803
            |          .:.|:|:   .::..|....|||.        .|...|:.....|..::..:  
Human   792 P----------RDVTVELGRSALLACRATGRPPPTVTWRRGDGQPLGLRLGAGRGSRSRQPDSGV 846

  Fly   804 -FFEGI--YDAASSDTSLRNAKQKIRSIKSTVLKSKDSTNYAQDTVQKAKARDFLHIFTPP--VK 863
             |||.:  .|.|......||...|:                      :|:||..:....||  ..
Human   847 LFFESVAPEDQAPYVCEARNVFGKV----------------------QAEARLIVTGHAPPQIAS 889

  Fly   864 KRPIYEIVE-EPVNI--FELEGDYTESIAD-----DFR--EPSADFEARGQSVGGMD----DYYS 914
            ..|...::| :||::  ..|.|   ..:.:     |.|  .|.:....|......:|    ::..
Human   890 SAPTVRVLEGQPVSLPCIVLAG---RPLPERHWLKDGRPLPPGSRHSIRADGSLHLDRALQEHAG 951

  Fly   915 GYSRASTRRYETKTRDYD-------------------RGTSYD------------STVERSQYGI 948
            .||..:|....::.||.:                   .|.:..            .|..:....:
Human   952 RYSCVATNTAGSQHRDVELVVQVPPRIHPTATHHITNEGVAASLPCVASGVPAPTITWTKETNAL 1016

  Fly   949 SSRRDRSSVDKVEARSSLLATGRTESRAASRAESRAESRASYSVAESRAGIRSSSRLQEDRPLRS 1013
            :||....:|.|    ...|...:..::.|......|.:...:|..|.|..:.:..|:..:.. |:
Human  1017 TSRGPHYNVSK----EGTLLIAQPSAQDAGAYVCTATNTVGFSSQEMRLSVNTKPRIHMNGS-RN 1076

  Fly  1014 VDKPVVVKMLKSVQVEPGETAHFEIQFK-DQPGLVTWLKDNKPLEDRLADRITQTAAPMNSYRLD 1077
            .|.|:      .|..:.||....:.:.| ..|.||||.||::|:..     ||.....:.|..|.
Human  1077 ADVPL------QVTAKAGEEVTLDCEAKGSPPPLVTWTKDSRPVPP-----ITNRYGLLPSGSLR 1130

  Fly  1078 IKNCSETDAGTYTIRAQ----SASETTTVSAQLAVGQAPGHDETKTNTEPAFLVSLKDAEMIENT 1138
            :......|:|.|...|.    |||....:..|:.....||         |..|..|....:..|.
Human  1131 LAQVQVGDSGHYECTASNPAGSASHRYVLGVQVPPQVQPG---------PRVLKVLVGEALDLNC 1186

  Fly  1139 LFRFMVKIIGDPKPRVKFYKDEKEILETNDRIQIIRDKDYLGFYELVIADVQKTDAGTYSCKATN 1203
            :..      |:|:|::.:.||.          .:::.:...|  .:..|.::.:|||.|.|:|:|
Human  1187 VAE------GNPEPQLSWSKDG----------VVLQGRGPQG--SVHFAAIRTSDAGRYRCEASN 1233

  Fly  1204 KHGEANCEAIATTVEDKNPFGA--LSGQI-LPAGE------------KPVFQWKRNGEEFDPEER 1253
            ..|....|.....:|..: :||  .||.: ..|||            ||...| |.|...:|   
Human  1234 SAGVDAWEVELRVLEPPH-WGADETSGLLERVAGENASLPCPARGTPKPQVTW-RKGPSSEP--- 1293

  Fly  1254 FKVLFGE------DEDSLALVFQHVKPEDAGIYTCVAQTSTGNISCSAELSVQGAIQTLNREPEK 1312
               |.|:      :|.||.|.  .|.|.|:|.|.|.|....|:.|..|:|.|.          ..
Human  1294 ---LHGQPGVAVLEEGSLFLA--SVSPADSGDYECQATNEVGSTSRRAKLVVY----------VP 1343

  Fly  1313 PTLVIEHREANAS--IGGSAILELQCKGFPKPAVQWKHDGEVIQVDDRHKFMYEDEESMSLVIKN 1375
            |::..:.|:||.|  .|.|..||....|||.|.:.|..|.::|.....|:.:   :|..||....
Human  1344 PSIREDGRKANVSGMAGQSLTLECDANGFPVPEIVWLKDAQLIPKVGGHRLL---DEGQSLHFPR 1405

  Fly  1376 VDTVDAGVYTIEAINELGQDESSINLVVKAPPKI---KKITDITCSAGETIKMEIEVEGFPQPTV 1437
            :...|:|:|:..|.|:.|..:...:|:|..||.:   ....::...||..::::....|.|.|.|
Human  1406 IQEGDSGLYSCRAENQAGTAQRDFHLLVLTPPSVLGAGAAQEVLGLAGADVELQCWTSGVPTPQV 1470

  Fly  1438 QVTNN-------GKDVTAESN---VKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKATNDLSQT 1492
            :.|.:       |..:..:.:   ::|:.|.:|                ..|.|...|.:...|.
Human  1471 EWTKDRQPVLPGGPHLQVQEDGQVLRITGSHVG----------------DEGRYQCVAFSPAGQQ 1519

  Fly  1493 SEYWSCTVKSKPVI-VKNFESEYIHGEKENVQMTVRIDAYPEAKLTWYHDETEIKITDSKYTVSS 1556
            :..:...|.:.|.| ..|...|....|...||:.......|...:||:.|...:. |.:|...:.
Human  1520 ARDFQLRVHAPPTIWGSNETGEVAVMEDHLVQLLCEARGVPTPNITWFKDGALLP-TSTKVVYTR 1583

  Fly  1557 DGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQLLIKCAP--EFTHKLKNITVAEGDSNVEL 1619
            .|.  .|::..|...|||.||.||:|..|:|..:|:|.:...|  |.......:..|.....|.|
Human  1584 GGR--QLQLGRAQSSDAGVYTCKASNAVGAAEKATRLDVYVPPTIEGAGGRPYVVKAVAGRPVAL 1646

  Fly  1620 VVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDYGKLED 1684
            ......:|.|...|:.:|:.:.|. |:.|...:|:..:|.....|::  |.|:|...:..|:...
Human  1647 ECVARGHPSPTLSWHHEGLPVAES-NESRLETDGSVLRLESPGEASS--GLYSCVASSPAGEAVL 1708

  Fly  1685 NCVVTVNCKPK--VKRGLKNVEVQEGKSFTLEVEVYSEPEAKIKWFKDGHEIYEDARIKISRDTQ 1747
            ...|.|...|:  |..||..|....|:...|..:....|...|:|.::|....|.|.::::....
Human  1709 QYSVEVQVPPQLLVAEGLGQVTTIVGQPLELPCQASGSPVPTIQWLQNGRPAEELAGVQVASQGT 1773

  Fly  1748 RIENYYLTLN------LARTEDAGT---------YEMKATNFIG--------------------- 1776
            .:...::.|:      ...|.:|||         :|..:.:.||                     
Human  1774 TLHIDHVELDHSGLFACQATNEAGTAGAEVEVSVHEFPSVSIIGGENITAPFLQPVTLQCIGDGV 1838

  Fly  1777 ------------------------------ETTSTCKVAVLTSEALSLEQTVTKTLIATTEEPEE 1811
                                          |...||....|..|  |..:...|.|:....||  
Human  1839 PTPSLRWWKDGVALAAFGGNLQIEKVDLRDEGIYTCAATNLAGE--SKREVALKVLVPPNIEP-- 1899

  Fly  1812 GAVPEIVHVDVFQQHSYESVPLKYEVIATGIPKPEAIWYHDGKPITPDKHTAITVDGDHYKLEVQ 1876
            |.|.:.|         .|:..:..|.:|:|:|.|:..|:...:|::......::|||  ..|.::
Human  1900 GPVNKAV---------LENASVTLECLASGVPPPDVSWFKGHQPVSSWMGVTVSVDG--RVLRIE 1953

  Fly  1877 SLDLVDAGEYKVVVQNKVGEKSHQGELSLSGIAEYRKPILTQGPGLK-DIKVNKGDKVCEPVVFT 1940
            ...|.|||.|:.|..|..|..    ||.. |:.....|.:|..|.|. .:.||      .||..|
Human  1954 QAQLSDAGSYRCVASNVAGST----ELRY-GLRVNVPPRITLPPSLPGPVLVN------TPVRLT 2007

  Fly  1941 AD----PAPEIVLLKDGQPVVETNNVKLKVDKKDAENGLVQYTCTLNILEAEIKDSGRYELKVKN 2001
            .:    |:|.::.||||.||.......|:|    ...|.|     |.:..|...|||||.....:
Human  2008 CNATGAPSPTLMWLKDGNPVSPAGTPGLQV----FPGGRV-----LTLASARASDSGRYSCVAVS 2063

  Fly  2002 KYGELVTSGWIDVLAKPEISG--LNDTKCLPGDTICFEALVQANPKPKVSWTRGNENLCNHENCE 2064
            ..||......:.|...|.|.|  || ...:..:::..|....|.|.|.:||.:....|.....  
Human  2064 AVGEDRQDVVLQVHMPPSILGEELN-VSVVANESVALECQSHAMPPPVLSWWKDGRPLEPRPG-- 2125

  Fly  2065 VIADVDADKYRLVFQSVSPCEDGKYTITATNSEGRAAVDFNLAVLVEKPTF-IVQPESQSIHDYR 2128
              ..:.|||..|........:.|.||..|.|..|.:...:||.|.| .|.| :.:..:.::.:..
Human  2126 --VHLSADKALLQVDRADVWDAGHYTCEALNQAGHSEKHYNLNVWV-APVFPLRESHTLTVREGH 2187

  Fly  2129 PVSTKVLVHGVPLPTIEWFKDDKPINYEAINKPGKDKLYAKEDTKKGTDQIESV---LDIKSFRE 2190
            |........|||.|.|.|.||.:|:       ||:.         .|...:.:|   |.:...:.
Human  2188 PTRLSCECRGVPFPKISWRKDGQPL-------PGEG---------AGLQHVSAVGRLLYLGQAQL 2236

  Fly  2191 NDVGAYTCVATNEIGVTKAPFKLAMLSLAPSFV--KKLDNALDVLQGEPLVLECCVDGSPLPTVQ 2253
            ...|.|||..:|.:|.:....:|. :.:.|...  ::....:.|:|.....|||...|.|.|||.
Human  2237 AQEGTYTCECSNVVGNSSQDLQLE-VHVPPQIAGPREPPTQVSVVQDGVATLECNATGKPPPTVT 2300

  Fly  2254 WLKDGDEVKPSESIKISTNPDGLVKLEINSCQPNDSGAYKLIISNPHG--EKVALCAVAVKPEEM 2316
            |.:||..|.....:::.....   .|.:...|...:|.|..:..|..|  |:....:|.|.||.:
Human  2301 WERDGQPVGAELGLQLQNQGQ---SLHVERAQAAHTGRYSCVAENLAGRAERKFELSVLVPPELI 2362

  Fly  2317 QPKFLKPITSQTVVVGEPLKLEAQVTGFPAPEVKWYKDGMLLRPSPEINFINSPNGQIGLIIDAA 2381
            ..  |.|:|:.|..:..||.|..:..|.|.|.::|::....:.|..:...:   .|...|.:...
Human  2363 GD--LDPLTNITAALHSPLTLLCEAMGIPPPAIRWFRGEEPVSPGEDTYLL---AGGWMLKMTQT 2422

  Fly  2382 QPLDAGVYKCLIANKGGEIEGVSKVEIVPKESKPVFVAELQDASSI----EGFPVKMDIKVVGNP 2442
            |..|:|:|.||.:|:.||......||::...|     .|.:|...:    :|....:...|.|:|
Human  2423 QEQDSGLYSCLASNEAGEARRNFSVEVLVPPS-----IENEDLEEVIKVLDGQTAHLMCNVTGHP 2482

  Fly  2443 KPKLQWFHNGHEI-KPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYV 2506
            :|||.||.:|..: :.||.||    :||.....:::... ..:|.|..||.|..|......:|.|
Human  2483 QPKLTWFKDGRPLARGDAHHI----SPDGVLLQVLQANL-SSAGHYSCIAANAVGEKTKHFQLSV 2542

  Fly  2507 --APK----ADETATEEAPQFVSALRDVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTPNERL 2565
              ||.    |:::|.||.        .|..:....|:..|  ::.|.|.:.|.|||.....: |.
Human  2543 LLAPTILGGAEDSADEEV--------TVTVNNPISLICEA--LAFPSPNITWMKDGAPFEAS-RN 2596

  Fly  2566 LMTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSSACNANVRKVYKPPVFTQKISDQQQVFGN 2630
            :....|.| ||.|..|:..|:|.|||::.|.|||  :..|.:|..:..|.:.......:..|...
Human  2597 IQLLPGTH-GLQILNAQKEDAGQYTCVVTNELGE--AVKNYHVEVLIPPSISKDDPLAEVGVKEV 2658

  Fly  2631 NAKIPVTVS------GVPYPDLEWYFQDKPIPKSEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIA 2689
            ..|:..|::      .||.|.:.||...:|:..|.:..:..:|  .:|.:...:..|.|.|.|:|
Human  2659 KTKVNSTLTLECESWAVPPPTIRWYKDGQPVTPSSRLQVLGEG--RLLQIQPTQVSDSGRYLCVA 2721

  Fly  2690 SNREGKDITQGRLDIVNEIKKHSRSEPPVFLKKIGDC---------------------DIYEGMV 2733
            :|..|:|  ....:::.::       ||:| :|:||.                     :|.|...
Human  2722 TNVAGED--DQDFNVLIQV-------PPMF-QKVGDFSAAFEILSREEEARGGVTEYREIVENNP 2776

  Fly  2734 AKFTACATGYPEPEVEWFKNDQKLFPSDRFLIDIEPNGLLRLTIKNVTEYDVGRYSCRIFNPYGD 2798
            |.........|.|::.|::.||.|...|.  :.:...|.: |.|..|...:.|||||:..|..|:
Human  2777 AYLYCDTNAIPPPDLTWYREDQPLSAGDE--VSVLQGGRV-LQIPLVRAENAGRYSCKASNEVGE 2838

  Fly  2799 DICHAELFYDS----LDSQQKPLEDQYTDFKKYKKSGAPPPLSEGPIISRMTDRGLLLSWNPSVP 2859
            |..|.||...:    |...::.:|:...:.........|...:..|.||.:.:.   |.::||  
Human  2839 DWLHYELLVLTPPVILGDTEELVEEVTVNASSTVSLQCPALGNPVPTISWLQNG---LPFSPS-- 2898

  Fly  2860 LTPRYPITYQIEMMDLPEGDWRTLRTG----VRSCACDIRNLEPFRDYRFRVRVENKFGVSDPSP 2920
              ||..:        |.:|....:.|.    ..|..|...|.....:..|.:||:          
Human  2899 --PRLQV--------LEDGQVLQVSTAEVADAASYMCVAENQAGSAEKLFTLRVQ---------- 2943

  Fly  2921 YTQTYRQKLVPDPPKTYTYLPP---GTDFRPETSPYFPKDFDIERPPHDGLAQAPQFLLREQDIS 2982
                               :||   |.|....|:                               
Human  2944 -------------------VPPRIAGLDLEQVTA------------------------------- 2958

  Fly  2983 YGVKDHNTELMWFVYGYPKPKMTYYFDDMLIESGGRFDQSYTRNGQATLFINKMLDRDVGWYEAV 3047
              :.:.:..|...|:.:|.|::|:|.|...:..|   ::.:...|..||.:.:....|.|.|...
Human  2959 --ILNSSVSLPCDVHAHPNPEVTWYKDSQALSLG---EEVFLLPGTHTLQLGRARLSDSGMYTCE 3018

  Fly  3048 ATNEHGEARQRVRLEIAEHPRFLKRP----DETFIMARKNGRIEAKLVGIPLPEVHWFKDWKPIV 3108
            |.|..|..::.|:|.:...|.|.:.|    |...:.......:..:...:|.|.|.|:||.:|:|
Human  3019 ALNAAGRDQKLVQLSVLVPPAFRQAPRGPQDAVLVRVGDKAVLSCETDALPEPTVTWYKDGQPLV 3083

  Fly  3109 DSSRIKISSYDPDIYVLSIHDSIIKDGGLYSISARNIAGSISTSVTVHIE-----ENEDQYIYKT 3168
            .:.|.:.......   |.|.::.:.|.||||....|:||....:.|:.::     ||........
Human  3084 LAQRTQALRGGQR---LEIQEAQVSDKGLYSCKVSNVAGEAVRTFTLTVQVPPTFENPKTETVSQ 3145

  Fly  3169 YGRHPYVRSKQLR---------YQDKYDIGDE-----LGRG----------TQGITYHAVE---- 3205
            ....|.|.:..:.         .:|:..:...     :.||          .|..||..|.    
Human  3146 VAGSPLVLTCDVSGVPAPTVTWLKDRMPVESSAVHGVVSRGGRLQLSRLQPAQAGTYTCVAENTQ 3210

  Fly  3206 -----------------RSSGDNYAAKIMYGR------------------------------PEL 3223
                             ||||......::.|:                              |.|
Human  3211 AEARKDFVVAVLVAPRIRSSGVAREHHVLEGQEVRLDCEADGQPPPDVAWLKDGSPLGQDMGPHL 3275

  Fly  3224 RPFM-------------------------LNELEMMNTFNHKNLIRPYDAYDTDRSVTLIMELAA 3263
            |.::                         ..|...::|.|  .|:.|......|.|.||:   :.
Human  3276 RFYLDGGSLVLKGLRASDAGAYTCVAHNPAGEDARLHTVN--VLVPPTIKQGADGSGTLV---SR 3335

  Fly  3264 GGELV-----------------RDNLLRRDYYTERDIAHYIRQTLWGLEHMHEMGVGHMGLTIKD 3311
            .||||                 :|.|...  .::|.:.|               |.||   |::.
Human  3336 PGELVTMVCPVRGSPPIHVSWLKDGLPLP--LSQRTLLH---------------GSGH---TLRI 3380

  Fly  3312 LLISVVGGDI---IKVSDFGLSRKINRHNLSTLDYGMPEFVSPEVVNKEGVNFSHDMWTV----- 3368
            ..:.:....|   :..|..|::.:    |. ||...:|..:.|       |.|.:|:..|     
Human  3381 SKVQLADAGIFTCVAASPAGVADR----NF-TLQVQVPPVLEP-------VEFQNDVVVVRGSLV 3433

  Fly  3369 -----------GLITYVLLGGHNPFL---------------GIDDRET-----LTKIREGRWDFK 3402
                       .|::::..|  .|.|               |..|..|     :::..|.|..|:
Human  3434 ELPCEARGVPLPLVSWMKDG--EPLLSQSLEQGPSLQLEAVGAGDSGTYSCVAVSEAGEARRHFQ 3496

  Fly  3403 DEIW--THISDDGRDFISRLLLYSPEERMDVKTALKHP---WFFMLDRPVYDHDYQIGTDRLRN- 3461
            ..:.  .||.|.|:.....|...:|.|.:........|   |          |.......||.| 
Human  3497 LTVMEPPHIEDSGQPTELSLTPGAPMELLCDAQGTPQPNITW----------HKDGQALTRLENN 3551

  Fly  3462 ------------------YYDHFRDWYANASCKNYFRRRRLSGCFQHPSKMVYP----------P 3498
                              .|....:..|.|..|: ||.|     .|.|..:|.|          |
Human  3552 SRATRVLRVENVQVRDAGLYTCLAESPAGAIEKS-FRVR-----VQAPPNIVGPRGPRFVVGLAP 3610

  Fly  3499 GHVYTPENTPEPLPEPRIRAKREEVVSKYLHPDYELGLIQSESHYQYGPDTYLLQLRDVNFPVRL 3563
            |.:.. |.:.|..|.|:|...|:.:|            :|.::|.|:......|||:        
Human  3611 GQLVL-ECSVEAEPAPKITWHRDGIV------------LQEDAHTQFPERGRFLQLQ-------- 3654

  Fly  3564 REYMKVAHRRSPSFALNDSVDWSLPVIRERRRFTDIMDEEIDDERTRSRISMYAANESYSIRRLR 3628
                        :.:..||.|:|..                            |.|.:.|     
Human  3655 ------------ALSTADSGDYSCT----------------------------ARNAAGS----- 3674

  Fly  3629 TELGPRLDEYTEADAMIETQREGYPPFFREKPQTIAITENQPSHIHCFAVGDPKPCVQWFKNDMV 3693
            |.:..|::.:|             .|..|..|..:.::.||.:.:.|.|.|.|.|.|.| :.|.|
Human  3675 TSVAFRVEIHT-------------VPTIRSGPPAVNVSVNQTALLPCQADGVPAPLVSW-RKDRV 3725

  Fly  3694 LTESKRIKISVDEDGRSILRFEPALHFDVGVYKVVARNKVGQTVARCRIVVATLPD-APDSPEIS 3757
            ..:.:..:..:..:|.  ||.:|.|..|.|.|..:|.|..|.......:.|...|. ||....::
Human  3726 PLDPRSPRFEILPEGS--LRIQPVLAQDAGHYLCLASNSAGSDRQGRDLRVLEPPAIAPSPSNLT 3788

  Fly  3758 ANSGTEILLR-------------WKQPRDDGHSTVLCYSLQ---YKLSNCDAWTTVADNIDHEFY 3806
            ..:.|..||.             ||    ||..  |.:.||   |:|...:|....|..      
Human  3789 LTAHTPALLPCEASGSPKPLVVWWK----DGQK--LDFRLQQGAYRLLPSNALLLTAPG------ 3841

  Fly  3807 LLHDLQPNTNYQFRLASKNRIGWSE-----------------------MGIPV--SASTVGGDAP 3846
                  |..:.||.....|.:|.:.                       |..||  :..:.|..||
Human  3842 ------PQDSAQFECVVSNEVGEAHRLYQVTVHVPPTIADDQTDFTVTMMAPVVLTCHSTGIPAP 3900

  Fly  3847 KIHITKAMKHL------QQLTENGHQVVPEEERVHTD-YHCEREPPNWVTDSSVSDKYSFISEIA 3904
            .:..:||...|      .:::.:|...:.:...:|.. |.|...     ..:.|:.|:.|::..|
Human  3901 TVSWSKAGAQLGARGSGYRVSPSGALEIGQALPIHAGRYTCSAR-----NSAGVAHKHVFLTVQA 3960

  Fly  3905 RGEFSTIVKGIQKSTDTVVVAKIL 3928
                |.:||.:......|...::|
Human  3961 ----SPVVKPLPSVVRAVAEEEVL 3980

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ObscNP_001097440.1 RhoGEF 90..260 CDD:238091 3/11 (27%)
PH_unc89 275..388 CDD:270134 23/132 (17%)
Not5 <477..>652 CDD:444384 44/220 (20%)
Ig 1017..1108 CDD:472250 25/95 (26%)
Ig strand B 1034..1038 CDD:409353 0/3 (0%)
Ig strand C 1046..1050 CDD:409353 3/3 (100%)
Ig strand E 1074..1078 CDD:409353 1/3 (33%)
Ig strand F 1088..1093 CDD:409353 1/4 (25%)
Ig strand G 1101..1104 CDD:409353 0/2 (0%)
I-set 1123..1212 CDD:400151 19/88 (22%)
Ig strand B 1140..1144 CDD:409353 0/3 (0%)
Ig strand C 1153..1157 CDD:409353 0/3 (0%)
Ig strand E 1182..1186 CDD:409353 0/3 (0%)
Ig strand F 1196..1201 CDD:409353 2/4 (50%)
Ig strand G 1209..1212 CDD:409353 0/2 (0%)
Ig <1236..1299 CDD:472250 23/68 (34%)
Ig strand C 1238..1242 CDD:409353 0/3 (0%)
Ig strand E 1259..1269 CDD:409353 5/15 (33%)
Ig strand F 1279..1284 CDD:409353 2/4 (50%)
Ig strand G 1292..1295 CDD:409353 1/2 (50%)
I-set 1313..1403 CDD:400151 27/91 (30%)
Ig strand B 1330..1334 CDD:409353 1/3 (33%)
Ig strand C 1343..1347 CDD:409353 0/3 (0%)
Ig strand E 1369..1373 CDD:409353 2/3 (67%)
Ig strand F 1383..1388 CDD:409353 1/4 (25%)
Ig strand G 1396..1399 CDD:409353 0/2 (0%)
Ig_3 1406..1487 CDD:464046 16/93 (17%)
I-set 1499..1595 CDD:400151 29/96 (30%)
Ig strand B 1522..1526 CDD:409353 2/3 (67%)
Ig strand C 1535..1539 CDD:409353 1/3 (33%)
Ig strand E 1561..1565 CDD:409353 1/3 (33%)
Ig strand F 1575..1580 CDD:409353 2/4 (50%)
Ig strand G 1588..1591 CDD:409353 0/2 (0%)
Ig 1599..1690 CDD:472250 20/92 (22%)
Ig strand B 1617..1621 CDD:409353 2/3 (67%)
Ig strand C 1630..1634 CDD:409353 0/3 (0%)
Ig strand E 1656..1660 CDD:409353 1/3 (33%)
Ig strand F 1670..1675 CDD:409353 2/4 (50%)
Ig strand G 1683..1686 CDD:409353 0/2 (0%)
I-set 1694..1786 CDD:400151 24/159 (15%)
Ig strand B 1711..1715 CDD:409353 1/3 (33%)
Ig strand C 1724..1728 CDD:409353 1/3 (33%)
Ig strand E 1752..1756 CDD:409353 0/3 (0%)
Ig strand F 1766..1771 CDD:409353 2/13 (15%)
Ig strand G 1779..1782 CDD:409353 0/2 (0%)
Ig <1836..1903 CDD:472250 19/66 (29%)
Ig strand C 1846..1850 CDD:409353 0/3 (0%)
Ig strand E 1871..1875 CDD:409353 1/3 (33%)
Ig strand F 1885..1890 CDD:409353 1/4 (25%)
Ig 1922..2005 CDD:472250 25/87 (29%)
Ig strand B 1933..1937 CDD:409353 0/3 (0%)
Ig strand C 1946..1950 CDD:409353 0/3 (0%)
Ig strand E 1971..1984 CDD:409353 3/12 (25%)
Ig strand F 1994..1999 CDD:409353 2/4 (50%)
Ig 2018..2108 CDD:472250 24/91 (26%)
Ig strand B 2034..2038 CDD:409353 0/3 (0%)
Ig strand C 2047..2051 CDD:409353 1/3 (33%)
Ig strand E 2074..2078 CDD:409353 1/3 (33%)
Ig strand F 2088..2093 CDD:409353 2/4 (50%)
Ig strand G 2101..2104 CDD:409353 0/2 (0%)
Ig 2113..2214 CDD:472250 23/104 (22%)
Ig strand B 2130..2134 CDD:409353 0/3 (0%)
Ig strand C 2143..2147 CDD:409353 1/3 (33%)
Ig strand E 2176..2185 CDD:409353 2/11 (18%)
Ig strand F 2195..2200 CDD:409353 3/4 (75%)
I-set 2220..2302 CDD:400151 21/85 (25%)
Ig strand B 2238..2242 CDD:409353 1/3 (33%)
Ig strand C 2251..2255 CDD:409353 2/3 (67%)
Ig strand E 2277..2281 CDD:409353 1/3 (33%)
Ig strand F 2291..2296 CDD:409353 1/4 (25%)
Ig strand G 2304..2307 CDD:409353 0/2 (0%)
I-set 2318..2408 CDD:400151 24/89 (27%)
Ig strand B 2335..2339 CDD:409353 2/3 (67%)
Ig strand C 2348..2352 CDD:409353 0/3 (0%)
Ig strand E 2374..2378 CDD:409353 1/3 (33%)
Ig strand F 2388..2393 CDD:409353 2/4 (50%)
Ig 2415..2506 CDD:472250 25/95 (26%)
Ig strand B 2432..2436 CDD:409353 0/3 (0%)
Ig strand C 2445..2449 CDD:409353 2/3 (67%)
Ig strand E 2472..2476 CDD:409353 0/3 (0%)
Ig strand F 2486..2491 CDD:409353 1/4 (25%)
Ig strand G 2499..2502 CDD:409353 0/2 (0%)
I-set 2519..2608 CDD:400151 26/88 (30%)
Ig strand B 2536..2540 CDD:409353 1/3 (33%)
Ig strand C 2549..2553 CDD:409353 0/3 (0%)
Ig strand E 2574..2578 CDD:409353 2/3 (67%)
Ig strand F 2588..2593 CDD:409353 3/4 (75%)
I-set 2615..2696 CDD:400151 19/86 (22%)
Ig strand B 2632..2636 CDD:409353 1/3 (33%)
Ig strand C 2645..2649 CDD:409353 0/3 (0%)
Ig strand E 2670..2674 CDD:409353 1/3 (33%)
Ig strand F 2684..2689 CDD:409353 2/4 (50%)
Ig strand G 2697..2700 CDD:409353 0/2 (0%)
I-set 2717..2805 CDD:400151 28/108 (26%)
Ig strand B 2734..2738 CDD:409353 1/3 (33%)
Ig strand C 2747..2751 CDD:409353 0/3 (0%)
Ig strand E 2773..2777 CDD:409353 1/3 (33%)
Ig strand F 2787..2792 CDD:409353 4/4 (100%)
Ig strand G 2800..2803 CDD:409353 0/2 (0%)
FN3 2834..2925 CDD:238020 17/94 (18%)
Ig <2996..3063 CDD:472250 18/66 (27%)
Ig strand C 3003..3007 CDD:409353 1/3 (33%)
Ig strand E 3029..3033 CDD:409353 2/3 (67%)
Ig strand F 3043..3048 CDD:409353 1/4 (25%)
Ig strand G 3056..3059 CDD:409353 0/2 (0%)
Ig 3067..3157 CDD:472250 24/93 (26%)
Ig strand B 3085..3088 CDD:409353 0/2 (0%)
Ig strand C 3097..3101 CDD:409353 1/3 (33%)
Ig strand E 3123..3127 CDD:409353 1/3 (33%)
Ig strand F 3137..3142 CDD:409353 3/4 (75%)
Ig strand G 3150..3153 CDD:409353 0/2 (0%)
PK_Unc-89_rpt1 3182..3440 CDD:271011 66/409 (16%)
Ig 3654..3744 CDD:472250 25/89 (28%)
Ig strand B 3671..3675 CDD:409353 0/3 (0%)
Ig strand C 3684..3688 CDD:409353 1/3 (33%)
Ig strand E 3710..3714 CDD:409353 1/3 (33%)
Ig strand F 3724..3729 CDD:409353 1/4 (25%)
Ig strand G 3737..3740 CDD:409353 0/2 (0%)
FN3 3748..3840 CDD:238020 25/133 (19%)
STKc_Unc-89_rpt2 3893..4151 CDD:271014 9/36 (25%)
HMCN2NP_001278744.1 ChlD <3..207 CDD:440853
IG_like 434..513 CDD:214653 15/86 (17%)
IG_like 524..604 CDD:214653 13/79 (16%)
Ig strand B 534..538 CDD:409353 0/3 (0%)
Ig strand C 547..551 CDD:409353 0/3 (0%)
Ig strand E 570..574 CDD:409353 0/3 (0%)
Ig strand F 584..589 CDD:409353 1/4 (25%)
Ig strand G 597..600 CDD:409353 0/2 (0%)
I-set 608..692 CDD:400151 19/85 (22%)
Ig strand B 625..629 CDD:409353 1/3 (33%)
Ig strand C 638..642 CDD:409353 1/3 (33%)
Ig strand E 660..664 CDD:409353 1/3 (33%)
Ig strand F 674..679 CDD:409353 0/4 (0%)
Ig strand G 687..690 CDD:409353 0/2 (0%)
IG_like 712..782 CDD:214653 18/73 (25%)
Ig strand B 715..719 CDD:409353 0/3 (0%)
Ig strand C 728..732 CDD:409353 0/3 (0%)
Ig strand E 748..752 CDD:409353 1/3 (33%)
Ig strand F 762..767 CDD:409353 1/7 (14%)
IG_like 792..879 CDD:214653 21/118 (18%)
Ig strand B 803..807 CDD:409353 0/3 (0%)
Ig strand C 816..820 CDD:409353 0/3 (0%)
Ig strand E 845..849 CDD:409353 0/3 (0%)
Ig strand F 859..864 CDD:409353 0/4 (0%)
Ig strand G 872..875 CDD:409353 1/2 (50%)
I-set 885..972 CDD:400151 17/89 (19%)
Ig strand B 902..906 CDD:409353 1/3 (33%)
Ig strand C 916..920 CDD:409353 0/3 (0%)
Ig strand F 952..957 CDD:409353 2/4 (50%)
Ig strand G 965..968 CDD:409353 1/2 (50%)
Ig_3 975..1050 CDD:464046 9/78 (12%)
Ig 1080..1161 CDD:472250 24/91 (26%)
Ig strand B 1091..1095 CDD:409353 0/3 (0%)
Ig strand C 1104..1108 CDD:409353 3/3 (100%)
Ig strand E 1127..1131 CDD:409353 1/3 (33%)
Ig strand F 1141..1146 CDD:409353 1/4 (25%)
Ig strand G 1154..1157 CDD:409353 1/2 (50%)
Ig 1165..1246 CDD:472250 22/107 (21%)
Ig strand B 1182..1186 CDD:409353 0/3 (0%)
Ig strand C 1195..1199 CDD:409353 0/3 (0%)
Ig strand E 1212..1216 CDD:409353 1/5 (20%)
Ig strand F 1226..1231 CDD:409353 2/4 (50%)
Ig strand G 1239..1242 CDD:409353 0/2 (0%)
IG_like 1258..1340 CDD:214653 28/90 (31%)
Ig strand B 1269..1273 CDD:409353 0/3 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1271..1298 8/33 (24%)
Ig strand C 1282..1286 CDD:409353 1/4 (25%)
Ig strand E 1306..1310 CDD:409353 2/3 (67%)
Ig strand F 1320..1325 CDD:409353 2/4 (50%)
I-set 1354..1433 CDD:400151 24/81 (30%)
Ig strand B 1363..1367 CDD:409353 1/3 (33%)
Ig strand C 1376..1380 CDD:409353 0/3 (0%)
Ig strand E 1399..1403 CDD:409353 2/3 (67%)
Ig strand F 1413..1418 CDD:409353 1/4 (25%)
Ig strand G 1426..1429 CDD:409353 0/2 (0%)
IG_like 1446..1527 CDD:214653 15/96 (16%)
Ig strand B 1456..1460 CDD:409353 0/3 (0%)
Ig strand C 1469..1473 CDD:409353 1/3 (33%)
Ig strand E 1492..1497 CDD:409353 0/4 (0%)
Ig strand F 1507..1512 CDD:409353 1/4 (25%)
I-set 1542..1620 CDD:400151 24/80 (30%)
Ig strand B 1543..1554 CDD:409353 3/10 (30%)
Ig strand C 1563..1567 CDD:409353 1/3 (33%)
Ig strand E 1586..1590 CDD:409353 1/5 (20%)
Ig strand F 1600..1605 CDD:409353 2/4 (50%)
Ig 1632..1705 CDD:472250 16/75 (21%)
Ig strand B 1644..1648 CDD:409353 2/3 (67%)
Ig strand C 1657..1661 CDD:409353 0/3 (0%)
Ig strand E 1680..1684 CDD:409353 0/3 (0%)
Ig strand F 1694..1699 CDD:409353 2/4 (50%)
I-set 1729..1807 CDD:400151 14/77 (18%)
Ig strand B 1737..1741 CDD:409353 1/3 (33%)
Ig strand C 1750..1754 CDD:409353 1/3 (33%)
Ig strand E 1772..1777 CDD:409353 0/4 (0%)
Ig strand F 1787..1792 CDD:409353 0/4 (0%)
Ig strand G 1800..1803 CDD:409353 0/2 (0%)
Ig 1820..1893 CDD:472250 7/74 (9%)
Ig strand B 1829..1833 CDD:409353 0/3 (0%)
Ig strand C 1842..1846 CDD:409353 0/3 (0%)
Ig strand E 1857..1861 CDD:409353 0/3 (0%)
Ig strand F 1871..1876 CDD:409353 2/4 (50%)
Ig strand G 1884..1887 CDD:409353 0/2 (0%)
I-set 1895..1975 CDD:400151 25/96 (26%)
Ig strand B 1912..1916 CDD:409353 0/3 (0%)
Ig strand C 1925..1929 CDD:409353 0/3 (0%)
Ig strand E 1948..1952 CDD:409353 1/3 (33%)
Ig strand F 1962..1967 CDD:409353 1/4 (25%)
Ig strand G 1975..1978 CDD:409353 2/2 (100%)
Ig_3 1985..2061 CDD:464046 28/90 (31%)
Ig_3 2079..2154 CDD:464046 20/79 (25%)
Ig 2171..2261 CDD:472250 24/106 (23%)
Ig strand B 2189..2193 CDD:409353 0/3 (0%)
Ig strand C 2202..2206 CDD:409353 1/3 (33%)
Ig strand E 2227..2231 CDD:409353 1/3 (33%)
Ig strand F 2241..2246 CDD:409353 3/4 (75%)
Ig strand G 2254..2257 CDD:409353 0/2 (0%)
I-set 2273..2355 CDD:400151 21/84 (25%)
Ig strand B 2285..2289 CDD:409353 1/3 (33%)
Ig strand C 2298..2302 CDD:409353 2/3 (67%)
Ig strand E 2320..2325 CDD:409353 1/7 (14%)
Ig strand F 2335..2340 CDD:409353 1/4 (25%)
Ig 2367..2449 CDD:472250 23/84 (27%)
Ig strand B 2379..2383 CDD:409353 2/3 (67%)
Ig strand C 2392..2396 CDD:409353 0/3 (0%)
Ig strand E 2415..2419 CDD:409353 1/3 (33%)
Ig strand F 2429..2434 CDD:409353 2/4 (50%)
Ig strand G 2442..2445 CDD:409353 0/2 (0%)
I-set 2464..2542 CDD:400151 23/82 (28%)
Ig strand B 2472..2476 CDD:409353 0/3 (0%)
Ig strand C 2485..2489 CDD:409353 2/3 (67%)
Ig strand E 2508..2512 CDD:409353 0/3 (0%)
Ig strand F 2522..2527 CDD:409353 1/4 (25%)
Ig strand G 2535..2538 CDD:409353 0/2 (0%)
I-set 2560..2638 CDD:400151 27/91 (30%)
Ig strand B 2568..2572 CDD:409353 1/3 (33%)
Ig strand C 2581..2585 CDD:409353 0/3 (0%)
Ig strand E 2604..2608 CDD:409353 3/4 (75%)
Ig strand F 2618..2623 CDD:409353 3/4 (75%)
I-set 2656..2728 CDD:400151 18/73 (25%)
Ig strand B 2666..2670 CDD:409353 0/3 (0%)
Ig strand C 2679..2683 CDD:409353 0/3 (0%)
Ig strand E 2702..2706 CDD:409353 1/3 (33%)
Ig strand F 2716..2721 CDD:409353 2/4 (50%)
Ig 2770..2847 CDD:472250 25/79 (32%)
Ig strand B 2777..2781 CDD:409353 1/3 (33%)
Ig strand C 2790..2794 CDD:409353 0/3 (0%)
Ig strand E 2814..2817 CDD:409353 1/3 (33%)
Ig strand F 2827..2832 CDD:409353 4/4 (100%)
Ig strand G 2840..2843 CDD:409353 0/2 (0%)
I-set 2864..2942 CDD:400151 16/92 (17%)
Ig strand B 2872..2876 CDD:409353 0/3 (0%)
Ig strand C 2885..2889 CDD:409353 2/3 (67%)
Ig strand E 2907..2912 CDD:409353 1/4 (25%)
Ig strand F 2922..2927 CDD:409353 2/4 (50%)
IG_like 2954..3034 CDD:214653 20/115 (17%)
Ig strand B 2964..2968 CDD:409353 1/3 (33%)
Ig strand C 2977..2981 CDD:409353 1/3 (33%)
Ig strand E 3000..3004 CDD:409353 2/3 (67%)
Ig strand F 3014..3019 CDD:409353 1/4 (25%)
I-set 3038..3129 CDD:400151 24/93 (26%)
Ig strand B 3059..3063 CDD:409353 0/3 (0%)
Ig strand C 3072..3076 CDD:409353 1/3 (33%)
Ig strand E 3095..3099 CDD:409353 1/6 (17%)
Ig strand F 3109..3114 CDD:409353 3/4 (75%)
Ig_3 3132..3208 CDD:464046 11/75 (15%)
I-set 3238..3308 CDD:400151 4/69 (6%)
Ig strand B 3244..3248 CDD:409353 0/3 (0%)
Ig strand C 3257..3261 CDD:409353 0/3 (0%)
Ig strand E 3282..3286 CDD:409353 0/3 (0%)
Ig strand F 3296..3301 CDD:409353 0/4 (0%)
I-set 3335..3410 CDD:400151 18/99 (18%)
Ig strand B 3340..3344 CDD:409353 1/3 (33%)
Ig strand C 3353..3357 CDD:409353 0/3 (0%)
Ig strand E 3376..3380 CDD:409353 2/6 (33%)
Ig strand F 3390..3395 CDD:409353 1/4 (25%)
Ig 3424..3499 CDD:472250 12/76 (16%)
Ig strand B 3433..3437 CDD:409353 0/3 (0%)
Ig strand C 3446..3450 CDD:409353 1/3 (33%)
Ig strand E 3464..3469 CDD:409353 0/4 (0%)
Ig strand F 3479..3484 CDD:409353 1/4 (25%)
Ig strand G 3492..3495 CDD:409353 1/2 (50%)
Ig 3503..3590 CDD:472250 20/102 (20%)
Ig strand B 3522..3526 CDD:409353 1/3 (33%)
Ig strand C 3535..3539 CDD:409353 1/13 (8%)
Ig strand E 3556..3560 CDD:409353 0/3 (0%)
Ig strand F 3570..3575 CDD:409353 1/4 (25%)
Ig strand G 3583..3586 CDD:409353 1/3 (33%)
Ig 3602..3683 CDD:472250 24/146 (16%)
Ig strand C 3626..3630 CDD:409353 1/3 (33%)
Ig strand E 3648..3653 CDD:409353 1/4 (25%)
Ig strand F 3663..3668 CDD:409353 2/32 (6%)
Ig 3689..3765 CDD:472250 23/78 (29%)
Ig strand B 3704..3708 CDD:409353 0/3 (0%)
Ig strand C 3717..3721 CDD:409353 2/4 (50%)
Ig strand E 3740..3744 CDD:409353 2/5 (40%)
Ig strand F 3754..3759 CDD:409353 1/4 (25%)
Ig_3 3777..3854 CDD:464046 20/94 (21%)
Ig 3873..3958 CDD:472250 16/89 (18%)
Ig strand B 3888..3892 CDD:409353 1/3 (33%)
Ig strand C 3901..3905 CDD:409353 0/3 (0%)
Ig strand E 3924..3928 CDD:409353 1/3 (33%)
Ig strand F 3938..3943 CDD:409353 2/4 (50%)
Ig strand G 3951..3954 CDD:409353 1/2 (50%)
Ig_3 3962..4035 CDD:464046 4/19 (21%)
I-set 4052..4139 CDD:400151
Ig strand B 4069..4073 CDD:409353
Ig strand C 4082..4086 CDD:409353
Ig strand E 4105..4109 CDD:409353
Ig strand F 4119..4124 CDD:409353
Ig strand G 4132..4135 CDD:409353
I-set 4143..4228 CDD:400151
Ig strand B 4160..4164 CDD:409353
Ig strand C 4173..4177 CDD:409353
Ig strand E 4194..4198 CDD:409353
Ig strand F 4208..4213 CDD:409353
Ig strand G 4223..4226 CDD:409353
I-set 4246..4317 CDD:400151
Ig strand B 4250..4254 CDD:409353
Ig strand C 4263..4267 CDD:409353
Ig strand E 4285..4289 CDD:409353
Ig strand F 4299..4304 CDD:409353
Ig 4324..4409 CDD:472250
Ig strand B 4340..4344 CDD:409353
Ig strand C 4353..4357 CDD:409353
Ig strand E 4375..4379 CDD:409353
Ig strand F 4389..4394 CDD:409353
Ig strand G 4402..4405 CDD:409353
nidG2 4411..4625 CDD:469646
FXa_inhibition 4652..4687 CDD:464251
EGF_CA 4689..4732 CDD:214542
EGF_CA 4733..4766 CDD:214542
EGF_CA 4776..4805 CDD:429571
EGF_CA 4883..4922 CDD:214542
EGF_CA 4923..4963 CDD:214542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.