DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Unc-89 and Ttn

DIOPT Version :9

Sequence 1:NP_001097440.1 Gene:Unc-89 / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:NP_001372637.1 Gene:Ttn / 22138 MGIID:98864 Length:35463 Species:Mus musculus


Alignment Length:4935 Identity:1003/4935 - (20%)
Similarity:1674/4935 - (33%) Gaps:1429/4935 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAVADIVFVSRDYQAQSLATDEISVSRGDLVELISSKASEKSRCFVRMFDSGDSPKEGWVPI-- 63
            |..:|.::....|:|..|  :|....:..:.:||:|...:..::.        ||.:||..|:  
Mouse  3583 MKEIASLLSAEEDFQTYS--SDLRLPNANETLELLSEPPARSTQF--------DSRQEGAAPVFI 3637

  Fly    64 -----------DILEFNPTMS------------------SSNGKESGDAEFRKLTILRELVETEE 99
                       |:.:.:.|::                  |::.|...|.:...|.||....:.|.
Mouse  3638 REISDVEISVEDVAKLSVTVTGCPKPKIQWFFNGMLLTPSADYKFVFDGDTHSLIILFTRFQDEG 3702

  Fly   100 EF----SRDLLHVV--------------------EKYIKGIDKPVVPRSVRDNKDI--IFCNFLQ 138
            |:    |.:....|                    ||  |.::||..|......|::  :.|....
Mouse  3703 EYTCLASNEYGKAVCSAHLRISPRGERSTEMESGEK--KALEKPKGPCPPYFFKELKPVHCGPGI 3765

  Fly   139 IAEFHNNVLKEGLKCYSNQPNMVAKTFLRLERDFDKHVVYCQNEPLAQD----YLGSSP---DAK 196
            .|.|..:|        ..:|   |.|.|..:.|...:...|.....:.|    ::.:.|   |:.
Mouse  3766 PAVFEYSV--------HGEP---APTVLWFKEDMPLYTSVCYTIIHSPDGSGTFIVNDPQRGDSG 3819

  Fly   197 KYFQELSKQLGDDKSLAEHLKLPIQRINDYQLLFKDFIKYSLSLKENVKDLERALELMLSVPSRA 261
            .|..:.....|:....||.|.||           :|......|.||         |..|.||   
Mouse  3820 LYLCKAQNLWGESTCAAELLVLP-----------EDTDVPDASCKE---------ESTLGVP--- 3861

  Fly   262 YDNRFLSSIEGCRGNIYK--LGRLLLHAWCNVVDKEGKAHDRYCFLFKSRILVTKVRKISENRSV 324
              ..||.:  ..||.:.:  ..|..:.|:.     ||.       :.|:.::..:..::|..|||
Mouse  3862 --GDFLET--SARGPLVQGVDSRQEITAFA-----EGT-------ISKAALIAEETLQLSYERSV 3910

  Fly   325 -------FILQNIVKLPLCNI-------ELKADEKQIH----------LSLKAPEANSFLPIDIK 365
                   .:.....|||...:       ||.:.:..:|          |:|:|.:|.:.||    
Mouse  3911 DDSEVGTGVTIGAQKLPPVVLSTPQGTGELPSIDGAVHTQPGRGPPPTLNLQAVQAQTTLP---- 3971

  Fly   366 PHGPEAHLTWFNEISSHINQDVTLQEHNADDLKVDASQIASESEL----ILHLPQRAEAHDPNLS 426
                               ::.|||....:.:...||..|..|.:    ::.|....:.:.|..|
Mouse  3972 -------------------KEATLQFEEPEGVFPGASSAAQVSPVTIKPLITLTAEPKGNYPQSS 4017

  Fly   427 VRPSDVAENYFLSKETKERLQHEQQELLKLEQEAIELYKKQQSSKSVSSKTESVEITSSQVKSSS 491
            ....|.|   .||....|.||..::::.::::....|...|..::......|..::..|.::|..
Mouse  4018 TAAPDHA---LLSSVAAETLQLGEKKIPEVDKAQRALLLSQSLAEGCVESLEVPDVAVSNMRSEP 4079

  Fly   492 EVRKVVSPPPPPQAQVKEVTPVKVVSSPPPPKEITPAKVATPPPQPQVVTSPV----KEV-APPP 551
            :|        |.|   ...|..|::.:.....:.|...||....:.:.::.|:    |:| ....
Mouse  4080 QV--------PFQ---HTCTEGKILMASADTLKSTGQDVALRTEEGKSLSFPLALEEKQVLLKEE 4133

  Fly   552 QPRAVASPAKEVTPSQSEPVKAPSPIKEVRKE-------VPPSASHSKEV-------EALVATEI 602
            |...||.|..:.:.|:.|| :|...:||||::       :.||....:.:       .||.|...
Mouse  4134 QSEVVAVPTSQTSKSEKEP-EAIKGVKEVREQELLSKETLFPSMPEEQRLHLKTQVRRALQAAVA 4197

  Fly   603 RE----------SLTETRSTVVESGQS-------------SEIREEIVVTEESSLEGKQVVALER 644
            ||          ::.:...|.|...|.             |.:.||:.||.|..  ..|:..||.
Mouse  4198 REQANLFSEWLRNIDKVEVTAVNFTQEPKRILCTYLITSVSSLTEELTVTIEDI--DPQMANLET 4260

  Fly   645 --EPSPCSI------------PKI-------------------QVYRPVECENPVVTKHKPIELK 676
              :.:.|||            |:|                   :|...:|.|    ...|.:..|
Mouse  4261 GLKDALCSIVCEERNILMAEDPRIHEEDKIDVQGGRDHLSDAQKVETVIEAE----ADSKYLVSK 4321

  Fly   677 DIVGYSE---SLRDGDTAPAGGSPGRQQGYSANITDHASLTIWNNRLANIAGDRSGANQHLQQSG 738
            :.|.:|:   .|:||||               |....|...    :||..:|.:..:.:..|:..
Mouse  4322 EEVSWSKVESQLKDGDT---------------NEVPQAETL----KLAEESGTQKTSTEMSQEEA 4367

  Fly   739 PPPPPIPPNFTRMPGFFQPLPLIAYETTIEILIVKARPPSPPPPPPPTIKRVLVHTESLEQKTQN 803
                                     |.|:..|.             |.:.:.||.|.|.|..|.:
Mouse  4368 -------------------------EGTLADLC-------------PAVLKHLVDTISEEGDTVH 4394

  Fly   804 FFEGIYDA-----------ASSDTSLRNAK-QKIRSIKSTVLKSKDSTNY---AQDTVQKAKARD 853
            ....|.:|           ..||...:..| |...::....:|::|...|   |.:...|||...
Mouse  4395 LTSSISNAKEVHWYFKGNLVPSDGKFKCLKEQNAYTLVIEAVKTEDEGEYVCEASNDSGKAKTSA 4459

  Fly   854 FLHI--FTPPVKKRPIYEIVEEPVNI---------FELEGDYTESIADDFREPSADFEARGQSVG 907
            .|.:  ...||.||.|     ||:.:         .|::|           .|:..|:       
Mouse  4460 KLTVGERAAPVIKRRI-----EPLEVALGHLAKFTCEIQG-----------APNVRFQ------- 4501

  Fly   908 GMDDYYSGYSRASTRRYETKTRDYDRGTSYDSTVE--RSQY---GISSRRDRSSVDKVEARSSLL 967
                    :.:|....||:..... |.::|.|::|  |:|.   |..:.:..:....|...::|.
Mouse  4502 --------WFKAGREIYESDKCSI-RSSNYVSSLEILRTQVVDCGEYTCKASNEYGSVSCTATLT 4557

  Fly   968 ATGRTESRAASRAESRA------------------------ESRASYSV--------AESRAGIR 1000
            .|........||.::..                        :..|:.|.        |:::..:.
Mouse  4558 VTEAYPPTFLSRPKALTTFVGKAAKFLCTVSGTPVIEIIWQKDGAALSPSPDCRVTDADNKHSLE 4622

  Fly  1001 SSSRLQEDRPLRS------------------VDKPVVVKMLKSVQVEPGETAHFEIQF-KDQPGL 1046
            .|:...:||.:.|                  :|||..:|.|::||....:..|.|.|. :|:...
Mouse  4623 LSNLTVQDRGIYSCKASNKFGADICQAELTIIDKPHFIKELEAVQSAINKKIHLECQVDEDRKVT 4687

  Fly  1047 VTWLKDNKPL----------EDRLADRITQTAAPMNSYRLDIKNCSETDAGTYTIRAQSASETTT 1101
            :||.||.:.|          ||::|.             |:|......|:||||..|.:.:.:::
Mouse  4688 ITWSKDGQKLPAGKDYKIYFEDKIAS-------------LEIPLAKLKDSGTYTCTASNEAGSSS 4739

  Fly  1102 VSAQLAVGQAPGHDETKTNTEPAFLVSLKDAEMIENTLFRFMVKIIGDPKPRVKFYKDEKEILET 1166
            .||.:||.:.|...:   ..:|::|       |:.....|...|:.|.|..:|.::|:.||:.|:
Mouse  4740 SSAAVAVREPPSFVK---KVDPSYL-------MLPGESARLHCKLKGSPVIQVTWFKNNKELSES 4794

  Fly  1167 ND-RIQIIRDKDYLGFYELVIADVQKTDAGTYSCKATNKHGEANCEAIATTVEDKNP-------- 1222
            |. |:..:..:..|.     |.||:..|:|||||:|||..|..:|   :|.|..|.|        
Mouse  4795 NTVRMSFVNSEAILD-----ITDVKVDDSGTYSCEATNDVGSDSC---STEVVIKEPPSFIKTLE 4851

  Fly  1223 -----FGA---LSGQILPAGEKPVFQWKRNGEEFDPEERFKVLFGEDEDSLALVFQHVKPEDAGI 1279
                 .||   |..:|...|...| .|.::.::....:::: ||.: :..:.|........|.|.
Mouse  4852 PADIVRGANALLQCEIAGTGPFEV-NWFKDKKQIRSSKKYR-LFTQ-KTFVYLEISSFNSADVGD 4913

  Fly  1280 YTCVAQTSTGNISCSAELSVQGAIQTLNREPEKPTLVIEHREANASIGGSAILELQCKGFPKPAV 1344
            |.||.....|...|.|        ..|.:||  ||.|.:..:..|..|.:..|:...:|....:|
Mouse  4914 YECVVANEVGKCGCVA--------THLLKEP--PTFVKKVDDFTALAGQTVTLQAAVRGSEPISV 4968

  Fly  1345 QWKHDGEVIQVDDRHKFMYEDEESMSLVIKNVDTVDAGVYTIEAINELGQDESSINLVVKAPPK- 1408
            .|....|||:.|.:.|..:.:..:: |.|.:|.....|.||..|.||.|...|...|:||.|.| 
Mouse  4969 MWMKGQEVIKEDGKIKMSFSNGVAV-LTIPDVQISLGGKYTCLAENEAGSQTSVGELIVKEPAKI 5032

  Fly  1409 IKKITDITCSAGETIKMEIEVEGFPQPTVQVTNNGKDVTAESNVKIS------------------ 1455
            |::...|..:||:...:|..|.|.|:...:...:|:.:.|....:||                  
Mouse  5033 IERAELIQVTAGDPATLEYTVSGTPELKPKWYKDGRPLVASKKYRISFKNNIAQLKFYSAELHDS 5097

  Fly  1456 -------SSSIGKS-----------------------LEKVV----------------------- 1467
                   |:.:|.|                       ::.||                       
Mouse  5098 GQYTFEISNEVGSSSCETTFTVLDRDIAPLFTKPLRNVDSVVGGACRLDCKIAGSLPMRVSWFKD 5162

  Fly  1468 --------------------VEVKEIKLSQAGNYSIKATNDLSQTSEYWSCTVKSKP-VIVKNFE 1511
                                :|:..:.::.|||::.:|||.:.......:..|:..| .:.|...
Mouse  5163 GKELTASDRYQIAFVEGTASLEISRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPGS 5227

  Fly  1512 SEYIHGE--------KENVQMTVRIDAYPEAKLTWYHDETEIKITDSKYTVSSDGNAYTLKITGA 1568
            .:.:.|.        :.:..:|::          |:..:.|:....|.| ::.:.:..:|::...
Mouse  5228 RDVLPGSAVCLKSAFQGSAPLTIK----------WFKGDKELVSGGSCY-ITKETSESSLELYAV 5281

  Fly  1569 TRVDAGKYTVKATNEHGSATSSTQLLIKCAPEFTHKLKNITVAEGDSNVELVVGVDAYPRPHAKW 1633
            ...|:|.||.|.:|..||...|..|.:|....|..||:...:.:.....:|...|...|.....|
Mouse  5282 KTSDSGTYTCKVSNVAGSVECSADLFVKEPATFIEKLEPSQLLKKGDGTQLACKVTGTPPIKITW 5346

  Fly  1634 YIDGIEIDEKRNDFRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDYGKLEDNC--VVTVNCKPKV 1696
            :.:..|:.|.........|.... |.:..||....|.|.|:..|:.|  .|:|  :|.|...|..
Mouse  5347 FANDRELRESSKHKMSFAESTAV-LRLTDVAIEDSGEYMCEAQNEAG--SDHCTGIVIVKESPYF 5408

  Fly  1697 KRGLKNVEVQEGKSFTLEVEVYSEPEAKIKWFKDGHEIYEDARIKISRDTQRIENYYLTLNLART 1761
            .:..|::||.:.....|..||...|..:|.||||...:....:.|.....|.:....|....|  
Mouse  5409 TKEFKSIEVLKEYDVMLLAEVAGTPPFEITWFKDNTTLRSGRKYKTFLQDQLVSLQVLKFVAA-- 5471

  Fly  1762 EDAGTYEMKATNFIGETTSTCKVAVLTSEALSLEQTV--TKTLIATTEEPEEGAVPEIVHVDVFQ 1824
             |||.|:.:.||.:|  :|||...|...|..|..:.:  |.:|...|.              .||
Mouse  5472 -DAGEYQCRVTNEVG--SSTCSARVTLREPPSFIKKIEATSSLRGGTA--------------AFQ 5519

  Fly  1825 QHSYESVPLKYEVIATGIPKPEAIWYHDGKPITPDKHTAITVDGDHYKLEVQSLDLVDAGEYKVV 1889
            .....|:|:            ...|..|...||.|.:..:|.:.:...|.:..:::...|:|...
Mouse  5520 ATLKGSLPI------------TVTWLKDNDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQ 5572

  Fly  1890 VQNKVGEKSHQGELSLSGIAEYRKPILTQGPGLKDIKVNKGDKVCEPVVFTADPAPEIVLLKDGQ 1954
            .:|..|.:.....||:...|...:..::       |.|.:||.....|.|:..........||||
Mouse  5573 AKNDAGIQRCSALLSVKEPATIMEEAVS-------IDVTQGDPATLQVKFSGTKEISAKWFKDGQ 5630

  Fly  1955 PVVETNNVKLKVDKKDAENGLVQYTCTLNILEAEIKDSGRYELKVKNKYGE---LVTSGWIDVLA 2016
            .:  |...|.|:...|.       ...|.|:..|.||||.|..:|:|..|.   ..:...:|::.
Mouse  5631 EL--TLGPKYKISVTDT-------VSILKIISTEKKDSGEYTFEVQNDVGRSSCKASINVLDLII 5686

  Fly  2017 KPEIS-GLNDTKCLPGDTICFEALVQANPKPKVSWTRGNENLCNHENCEVIADVDADKYRL---- 2076
            .|..: .|.....:.|..|..|.:|..:....:.|.:.::        |:.|   :||::.    
Mouse  5687 PPSFTKKLRKMDSIKGSFIDLECIVAGSHPISIQWFKDDQ--------EISA---SDKHKFSFHD 5740

  Fly  2077 --VFQSVSPCE---DGKYTITATNSEGRAAVDFNLAVLVEKPTFIVQPESQSIHDYRPVSTKVLV 2136
              .|..:|..|   .|.||.:|||..|.:....:|.| .|.|.|:.:|:||.::....|..|.||
Mouse  5741 NTAFLEISQLEGTDSGTYTCSATNKAGHSQCSGHLTV-KEPPYFVEKPQSQDVNPGTRVQLKALV 5804

  Fly  2137 HGVPLPTIEWFKDDKPINYEAINKPGKDKLYAKEDTKKGTDQIESVLDIKSFRENDVGAYTCVAT 2201
            .|....||:||||:|.::      ||..:...|:||       .::|::.|.:..|.|.|.|..:
Mouse  5805 GGTAPMTIKWFKDNKELH------PGAARSVWKDDT-------STILELFSAKAADSGTYICQLS 5856

  Fly  2202 NEIGVTKAPFKLAMLSLAPSFVKKLDNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSES 2266
            |::|.|.:...: .:...|.|:||....|.:..|:....||.|.|:|...|.|..||:|:.....
Mouse  5857 NDVGTTSSKATI-FVKEPPQFIKKPSPVLVLRNGQSTTFECQVTGTPEIRVSWYLDGNEITDLRK 5920

  Fly  2267 IKISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKFLKPITSQTVVV 2331
            ..||. .|||...:|::.:..:||.|.....|..|  .|.|::.:|.:| .|.|::.:....||.
Mouse  5921 YGISF-VDGLATFQISNARVENSGTYVCEARNDAG--TASCSIELKVKE-PPIFIRELEPVEVVK 5981

  Fly  2332 GEPLKLEAQVTGFPAPEVKWYKDGMLLRPSPEINFINSPNGQIGLIIDAAQPLDAGVYKCLIANK 2396
            ...::||.:|.|....||.|.|:...:|...:.. ::.......|.|....|.|.|.|:|:|||:
Mouse  5982 DSDVELECEVMGTTPFEVTWLKNNKEIRSGKKYT-MSEKMSVFYLHITKCDPSDVGEYQCIIANE 6045

  Fly  2397 GGEIEGVSKVEIVPKESKPVFVAELQDASSIEGFPVKMDIKVVGNPKPKLQWFHNGHEIKP-DAS 2460
            ||.....::|.:   :..|.|:.::::.:::..........|.|:|...:.|..:...::. |..
Mouse  6046 GGSCACSARVAL---KEPPSFIKKIENVTTVLKSSATFQSTVAGSPPISITWLKDDQILEENDNV 6107

  Fly  2461 HIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKADETATEEAPQFVSAL 2525
            ||:.   .|:.::|.:.....|.||.|...|:|..|.....|.|.|         :|..|.:...
Mouse  6108 HISF---EDSVATLQVRSVDNGHSGRYTCQAKNESGIERCYAFLLV---------QEPAQIIEKA 6160

  Fly  2526 RDVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNYT 2590
            :.|:..|...:.|.......|..:|.|.|||..:.|:....|:.:.......|:.....|||.||
Mouse  6161 KSVDVTEKDPVTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYT 6225

  Fly  2591 CLLANPLGEDSSACNANVRKVYK--PPVFTQKISDQQQVFGNNAKIPVTVSGVPYPDLEWYFQDK 2653
            ..:.|..|  ||:|:|.:|.:.:  ||.||:|::...:|.|::..:...|||......:|:...|
Mouse  6226 FKVENDFG--SSSCDAYLRVLDQDIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGK 6288

  Fly  2654 PIPKSEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIVNEIKKHSRSEPPV 2718
            .|..|.||.:....:...|.|:|.|..|...|.|..||..|.:...|.|.:         .|||.
Mouse  6289 EISTSAKYRLVCHENTVSLEVSNLELEDTANYTCKVSNVAGDNACSGILTV---------KEPPS 6344

  Fly  2719 FLKKIGDCDIYEGMVAKFTACATGYPEPEVEWFKNDQKLFPSDRFLIDIEPNGLLRLTIKNVTEY 2783
            ||.|............:|.|...|.|..:::|.|:|.:|....:..|.:|.:... |.:.:|...
Mouse  6345 FLVKPERQQAIPDSTVEFKAVLKGTPPFKIKWLKDDVELVSGPKCFIGLEGSTSF-LNLYSVDSS 6408

  Fly  2784 DVGRYSCRIFNPYGDDICHAEL-------FYDSLDSQQ----------------KP--------L 2817
            ..|:|:|::.|..|.|.|...|       |...|::.:                .|        .
Mouse  6409 KTGQYTCQVTNDVGSDSCTTMLLVTEPPKFVKKLEASKIIKAGDSARLECKITGSPEIQVVWYRN 6473

  Fly  2818 EDQYTDFKKY------------------KKSG-----APPP-----------LSEGPIISRMTDR 2848
            |.:.|...||                  :.||     |..|           :.|.|:.|     
Mouse  6474 EHELTASDKYQMTFIDSVAVIQMNSLGTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFS----- 6533

  Fly  2849 GLLLSWNPSVPLTPRYPITYQIEMMDLP--EGDW----RTLRT---------------------- 2885
                |:.|.|.......::.:.|:...|  |..|    |.||:                      
Mouse  6534 ----SFPPIVETLKNTEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKVASKNFHASIHILNVES 6594

  Fly  2886 --------------GVRSCACDIR----------------------------------------- 2895
                          |..:|.|.::                                         
Mouse  6595 TDIGEYHCKAQNEVGSDACVCAVKLKEPPKFISKLNSLTVVAGEPAELQASIEGAQPISVQWLKE 6659

  Fly  2896 -------------------------NLEPFRDYRFRVRVENKFGVSDPSPYTQTYRQKLVPDPPK 2935
                                     .:||....::..:|:|..||          |:.:.     
Mouse  6660 KEEVIRESENIRISFVNNVATLQFAKVEPANAGKYICQVKNDGGV----------RENMA----- 6709

  Fly  2936 TYTYLPP-------------------------GTDFRPETSPYFPKD------------------ 2957
            |.|.|.|                         ||   ||.|..:.||                  
Mouse  6710 TLTVLEPAVIIEKAGSMTVTVGETCALECKVAGT---PELSVEWYKDGKLLTSSQKHKFSFYNKI 6771

  Fly  2958 -----------------FDIERPPHDGLAQA----------PQFLLREQDISYGVKDHNTELMWF 2995
                             |.::.........|          |.|..|.:|.. ||...:..|...
Mouse  6772 SSLKILSVEKEDAGTYTFQVQNNVGKSSCTAVVDVSDRMVPPSFTRRLKDTG-GVLGTSCILECK 6835

  Fly  2996 VYGYPKPKMTYYFDDMLIESGGRFDQSYTRNGQATLFINKMLDRDVGWYEAVATNEHGEARQRVR 3060
            |.|.....:.::.:...|.||.::..:::.| ..||.:|.:...|:|.|..||.|..|....|..
Mouse  6836 VAGSSPISIAWFHEKTKIVSGAKYQTTFSDN-VCTLQLNSLDSSDMGSYTCVAANVAGSDECRAL 6899

  Fly  3061 LEIAEHPRFLKRPDETFIMARKNGRIEAKLVGIPLPEVHWFKDWKPIVDSSRIKISSYDPDIYVL 3125
            |.:.|.|.|:|.|:...::..||....:.:.|.|..:|.||:..:.:|..:|..| .::..:..|
Mouse  6900 LTVQEPPSFVKEPEPLEVLPGKNITFTSVIRGTPPFKVGWFRGARELVKGNRCNI-YFEDTVAEL 6963

  Fly  3126 SIHDSIIKDGGLYSISARNIAGSISTSVTVHIEENEDQYIYKTYGRHPYVRSKQLRYQDKY---- 3186
            .:.:..|...|.|:....|.||..|.:..:.::  |.....|....|.....|.:..:..|    
Mouse  6964 ELFNIDISQSGEYTCVVSNNAGQASCTTRLFVK--EPATFVKKLSDHSVEPGKSIILEGTYTGTL 7026

  Fly  3187 ---------------------------------------------DIGDELGR-------GTQGI 3199
                                                         :|.:|.||       .|...
Mouse  7027 PISVTWKKDGVSITPSERCNIVTTEKTCILEILSSTKGDAGHYSCEIENEAGRDACDALVSTLEP 7091

  Fly  3200 TY-----HAVERSSGDNYAAKI------------------MYGRPELRPFMLNELEMMNTFN--- 3238
            .|     ..:|.|.||:.:.:.                  :...||.|.:..|.:..: .||   
Mouse  7092 PYFVTELEPLEASVGDSVSLQCQVAGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATL-VFNKVS 7155

  Fly  3239 -------------------HKNLIRPYDAY----------DTDRS----VTLIMELAAGGEL--- 3267
                               .|.:.|..:..          |.:::    |||...|.....:   
Mouse  7156 INDSGEYTCMAENSIGTAASKTIFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVC 7220

  Fly  3268 -VRDNLLRRD------YYTERDIAHYIRQTLWGLEHMHEMG------VGHMGLT----------- 3308
             .||.:|.||      .:.:......|.||  .|.|..:..      :|....|           
Mouse  7221 WYRDGVLLRDDENLQMSFVDNVATLKILQT--DLSHSGQYSCSASNPLGTASSTARLTAREPKKS 7283

  Fly  3309 ----IKDLLISVVGGDIIKVSDFGLSRKINRHNLSTLDYGMPEFVSPEVVNKE---GVNFSHDMW 3366
                ||.:.|.|:.|:         |.....|    :....|..|:....|||   |.|::    
Mouse  7284 PFFDIKPVSIDVIAGE---------SADFECH----VTGAQPMRVTWSKDNKEIRPGGNYT---- 7331

  Fly  3367 TVGLITYVLLGGHNPFLGIDDRETLTKIREGRWDFKDEIWTHISDDGRDFIS-RLLLYSPE---E 3427
                ||.|   |:.|.|.|        ::.|:.|.........:|.|:|..| :|.:..|.   :
Mouse  7332 ----ITCV---GNTPHLRI--------LKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFIK 7381

  Fly  3428 RMDVKTALKHPWFFMLDRPVYDHDYQIGTDRLRNYYDHFRDWYANASCKNYFRRRRLSG------ 3486
            ::|.....|......|:..: ....:|.....||..:....|..|.|..|......::.      
Mouse  7382 KLDASKVAKQGESIQLECKI-SGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEASAEDT 7445

  Fly  3487 ----CFQHPS----------KMVYPPGHVYTPENTPEPL-------------------------- 3511
                |..|..          |:..||  |:|.:  |.|:                          
Mouse  7446 GDYICEAHNGVGDASCSTALKVKAPP--VFTQK--PPPVGALKGSDVILQCEISGTPPFEVVWVK 7506

  Fly  3512 PEPRIR-AKREEVVSK----YLH------PDYELGLIQSESHYQYGPDT------------YLLQ 3553
            ...::| :|:.::.||    .||      ||  :|....::..:.|.||            ::.:
Mouse  7507 DRKQVRSSKKFKITSKNFDTSLHIFNLEAPD--IGEYHCKATNEVGSDTCACTVKFKEPPRFVKK 7569

  Fly  3554 LRD----VNFPVRLREYMKVAHRRSPSFALNDSVDW---SLPVIRERRRFTDIMDEEIDDERTRS 3611
            |.|    :..||.|:   .|.....|.     ||.|   ...||||..   ::....:|:..|..
Mouse  7570 LSDASTLIGDPVELQ---AVVEGFQPI-----SVVWLKDKGEVIRESE---NVRISFVDNIATLQ 7623

  Fly  3612 RISMYAANESYSIRRLRTELGPRLDEYTEADAMIETQREGYPPFFREKPQTIAITENQPSHIHCF 3676
            ..|..|:.....:.:::.:.|.|     |..|::....   |....|||:.:.:|...|..:.|.
Mouse  7624 LGSPEASQSGKYVCQIKNDAGMR-----ECSAVLTVLE---PATIVEKPEPMTVTTGNPFTLECV 7680

  Fly  3677 AVGDPKPCVQWFKNDMVLTESKRIKISVDEDGRSILRFEPALHFDVGVYKVVARNKVGQTVARCR 3741
            ..|.|:...:|||:...|:...|..|:...:..| |:...|...|.|:|.....|:||::.....
Mouse  7681 VAGTPELSAKWFKDGRELSSGSRHHITFVRNLAS-LKIPSAEMNDKGLYTFEVENRVGKSSCTVS 7744

  Fly  3742 IVVATLPDAPD----SPEISANSGTEILLR------------W--------KQPR-----DDGHS 3777
            :.|:.....|.    ..:.||..|..::|.            |        ..|:     .|...
Mouse  7745 VHVSDRVVPPSFVRRLKDTSATLGASVVLECRVSGSAPISVGWFLDGNEIISSPKCQSSFADNVC 7809

  Fly  3778 TVLCYSLQYKLSNCDAWTTVADNI---DHEFYLLH--------------DLQPNTNYQFRLASKN 3825
            |:...||:  .|:..|:|.||.|:   |....:|.              ::.|..:..|....:.
Mouse  7810 TLTLSSLE--PSDTGAYTCVAANVAGQDESSAVLTVQEPPSFEQTPDSVEVLPGMSLTFTSVIRG 7872

  Fly  3826 ----RIGWSEMGIPVSASTVGGDAPKIHITKAMKHLQQLTENGHQVVPEEERVHTDYHC------ 3880
                ::.|    ...|...|.|:|..|.:...:..|:.|     :|.|.:.   .||.|      
Mouse  7873 TPPFKVKW----FKGSRELVSGEACTISLEDFVTELELL-----EVEPGQS---GDYSCLVTNDA 7925

  Fly  3881 ----------EREPPNWV---TDSSVSDKYSFISEIARGEFSTIVKGIQK--------------S 3918
                      .:||..:|   .|:||......:.|........|.....|              :
Mouse  7926 GSASCTTHLFVKEPATFVKRLADTSVETGSPIVLEATYSGTPPISVSWMKNEYPLSQSPNCGITT 7990

  Fly  3919 TDTVVVAKILEVTDENEDNVVAEFDNFKTLRHERIPALFSAYKPLNVPIAIFVMEKLQGA 3978
            |:...:.:|||.|.|:........:|  ....:...||.|..:|   |..|..:|.::.|
Mouse  7991 TEKSSILEILESTIEDYAQYACLIEN--EAGQDICEALVSVLEP---PYFIEPLEHVEAA 8045

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Unc-89NP_001097440.1 RhoGEF 90..260 CDD:238091 41/202 (20%)
PH_unc89 275..388 CDD:270134 22/138 (16%)
Atrophin-1 <493..690 CDD:331285 57/274 (21%)
TonB_N 502..>596 CDD:318287 24/112 (21%)
I-set 1017..1108 CDD:333254 27/101 (27%)
I-set 1123..1212 CDD:254352 29/89 (33%)
I-set <1236..1299 CDD:333254 13/62 (21%)
I-set 1313..1403 CDD:254352 26/89 (29%)
Ig_3 1406..1487 CDD:316449 24/172 (14%)
I-set 1499..1595 CDD:254352 20/104 (19%)
I-set 1599..1690 CDD:333254 21/92 (23%)
I-set 1694..1786 CDD:254352 27/91 (30%)
I-set <1836..1903 CDD:333254 11/66 (17%)
I-set 1922..2005 CDD:333254 24/82 (29%)
I-set 2018..2108 CDD:333254 22/99 (22%)
I-set 2113..2214 CDD:333254 31/100 (31%)
I-set 2220..2302 CDD:254352 26/81 (32%)
I-set 2318..2408 CDD:254352 26/89 (29%)
I-set 2415..2506 CDD:254352 20/91 (22%)
I-set 2519..2608 CDD:254352 24/88 (27%)
I-set 2615..2696 CDD:254352 25/80 (31%)
I-set 2717..2805 CDD:254352 23/87 (26%)
FN3 2834..2925 CDD:238020 23/209 (11%)
I-set <2996..3063 CDD:333254 18/66 (27%)
I-set 3067..3157 CDD:333254 22/89 (25%)
PK_Unc-89_rpt1 3182..3440 CDD:271011 67/410 (16%)
I-set 3654..3744 CDD:333254 23/89 (26%)
FN3 3748..3840 CDD:238020 23/141 (16%)
STKc_Unc-89_rpt2 3893..4151 CDD:271014 19/100 (19%)
TtnNP_001372637.1 IgI_1_Titin_Z1z2-like 6..98 CDD:409566
Ig strand B 23..27 CDD:409566
Ig strand C 36..40 CDD:409566
Ig strand E 63..67 CDD:409566
Ig strand F 77..82 CDD:409566
Ig strand G 90..93 CDD:409566
IgI_2_Titin_Z1z2-like 103..193 CDD:409564
Ig strand B 121..125 CDD:409564
Ig strand C 134..138 CDD:409564
Ig strand E 159..163 CDD:409564
Ig strand F 173..178 CDD:409564
Ig strand G 186..189 CDD:409564
PRK12323 <253..>346 CDD:237057
Titin_Z 465..504 CDD:401109
Titin_Z 511..548 CDD:401109
Titin_Z 555..594 CDD:401109
Titin_Z 601..640 CDD:401109
Titin_Z 647..685 CDD:401109
Ig strand A 945..948 CDD:409353
I-set 946..1035 CDD:400151
Ig strand A' 951..955 CDD:409353
Ig strand B 963..971 CDD:409353
Ig strand C 976..981 CDD:409353
Ig strand C' 984..986 CDD:409353
Ig strand D 992..997 CDD:409353
Ig strand E 1000..1005 CDD:409353
Ig strand F 1014..1022 CDD:409353
Ig strand G 1025..1035 CDD:409353
I-set 1084..1173 CDD:400151
Ig strand A 1084..1087 CDD:409353
Ig strand A' 1090..1095 CDD:409353
Ig strand B 1100..1107 CDD:409353
Ig strand C 1114..1120 CDD:409353
Ig strand C' 1121..1124 CDD:409353
Ig strand D 1130..1137 CDD:409353
Ig strand E 1140..1150 CDD:409353
Ig strand F 1154..1162 CDD:409353
Ig strand G 1164..1173 CDD:409353
Ig 1295..1383 CDD:416386
Ig strand A' 1299..1304 CDD:409353
Ig strand B 1309..1316 CDD:409353
Ig strand C 1323..1329 CDD:409353
Ig strand C' 1330..1333 CDD:409353
Ig strand D 1339..1345 CDD:409353
Ig strand E 1348..1358 CDD:409353
Ig strand F 1362..1370 CDD:409353
Ig strand G 1372..1383 CDD:409353
Ig 1463..1553 CDD:416386
Ig strand A 1463..1466 CDD:409353
Ig strand A' 1469..1474 CDD:409353
Ig strand B 1479..1486 CDD:409353
Ig strand C 1493..1499 CDD:409353
Ig strand C' 1500..1503 CDD:409353
Ig strand D 1509..1515 CDD:409353
Ig strand E 1518..1528 CDD:409353
Ig strand F 1532..1540 CDD:409353
Ig strand G 1542..1553 CDD:409353
Ig 1562..1653 CDD:416386
Ig strand A 1562..1564 CDD:409353
Ig strand A' 1566..1572 CDD:409353
Ig strand B 1579..1586 CDD:409353
Ig strand C 1592..1597 CDD:409353
Ig strand C' 1599..1602 CDD:409353
Ig strand D 1610..1613 CDD:409353
Ig strand E 1618..1625 CDD:409353
Ig strand F 1632..1640 CDD:409353
Ig strand G 1643..1654 CDD:409353
Ig <1728..1800 CDD:416386
Ig strand C 1741..1746 CDD:409353
Ig strand C' 1749..1751 CDD:409353
Ig strand D 1757..1762 CDD:409353
Ig strand E 1765..1770 CDD:409353
Ig strand F 1779..1787 CDD:409353
Ig strand G 1790..1800 CDD:409353
I-set 1847..1935 CDD:400151
Ig strand A 1847..1849 CDD:409353
Ig strand A' 1851..1857 CDD:409353
Ig strand B 1864..1871 CDD:409353
Ig strand C 1877..1882 CDD:409353
Ig strand C' 1884..1887 CDD:409353
Ig strand E 1900..1907 CDD:409353
Ig strand F 1914..1922 CDD:409353
Ig strand G 1925..1936 CDD:409353
IgI_titin_I1-like 2084..2175 CDD:409543
Ig strand B 2101..2105 CDD:409543
Ig strand C 2114..2118 CDD:409543
Ig strand E 2140..2144 CDD:409543
Ig strand F 2154..2159 CDD:409543
Ig strand G 2167..2170 CDD:409543
Ig 2182..2268 CDD:416386
Ig strand A 2184..2186 CDD:409353
Ig strand A' 2189..2193 CDD:409353
Ig strand B 2197..2203 CDD:409353
Ig strand C 2210..2215 CDD:409353
Ig strand C' 2218..2221 CDD:409353
Ig strand D 2226..2231 CDD:409353
Ig strand E 2234..2239 CDD:409353
Ig strand F 2248..2253 CDD:409353
Ig 2274..2358 CDD:416386
Ig strand A' 2279..2284 CDD:409353
Ig strand B 2289..2296 CDD:409353
Ig strand C 2299..2308 CDD:409353
Ig strand C' 2309..2312 CDD:409353
Ig strand D 2318..2324 CDD:409353
Ig strand E 2326..2336 CDD:409353
Ig 2363..2434 CDD:416386
Ig strand A' 2368..2373 CDD:409353
Ig strand B 2378..2385 CDD:409353
Ig strand C 2391..2397 CDD:409353
Ig strand C' 2398..2401 CDD:409353
Ig strand D 2407..2413 CDD:409353
Ig strand E 2415..2425 CDD:409353
Ig 2453..2536 CDD:416386
Ig strand A' 2460..2463 CDD:409353
Ig strand B 2467..2473 CDD:409353
Ig strand C 2481..2486 CDD:409353
Ig strand C' 2489..2492 CDD:409353
Ig strand D 2497..2502 CDD:409353
Ig strand E 2505..2510 CDD:409353
Ig strand F 2519..2525 CDD:409353
Ig strand G 2528..2536 CDD:409353
Ig 2540..2623 CDD:416386
Ig strand C 2568..2573 CDD:409353
Ig strand C' 2576..2579 CDD:409353
Ig strand D 2584..2589 CDD:409353
Ig strand E 2592..2597 CDD:409353
Ig strand F 2606..2612 CDD:409353
Ig strand G 2615..2623 CDD:409353
Ig 2628..2710 CDD:416386
Ig strand C 2655..2660 CDD:409353
Ig strand C' 2663..2666 CDD:409353
Ig strand D 2671..2676 CDD:409353
Ig strand E 2679..2684 CDD:409353
Ig strand F 2693..2699 CDD:409353
Ig strand G 2702..2710 CDD:409353
Ig 2714..2798 CDD:416386
Ig strand A' 2717..2723 CDD:409353
Ig strand B 2730..2737 CDD:409353
Ig strand C 2743..2748 CDD:409353
Ig strand C' 2750..2753 CDD:409353
Ig strand D 2758..2762 CDD:409353
Ig strand E 2767..2774 CDD:409353
Ig strand G 2788..2799 CDD:409353
Ig 2802..2885 CDD:416386
Ig strand A' 2807..2812 CDD:409353
Ig strand B 2817..2824 CDD:409353
Ig strand C 2831..2836 CDD:409353
Ig strand C' 2837..2840 CDD:409353
Ig strand D 2846..2851 CDD:409353
Ig strand E 2854..2864 CDD:409353
Ig strand G 2875..2885 CDD:409353
Ig 2889..2972 CDD:416386
Ig strand A' 2892..2898 CDD:409353
Ig strand B 2905..2912 CDD:409353
Ig strand C 2918..2922 CDD:409353
Ig strand C' 2924..2927 CDD:409353
Ig strand D 2932..2936 CDD:409353
Ig strand E 2941..2948 CDD:409353
Ig strand F 2955..2963 CDD:409353
Ig 2977..3059 CDD:416386
Ig strand A' 2979..2985 CDD:409353
Ig strand B 2992..3001 CDD:409353
Ig strand C 3004..3009 CDD:409353
Ig strand C' 3011..3014 CDD:409353
Ig strand D 3019..3023 CDD:409353
Ig strand E 3028..3035 CDD:409353
Ig strand G 3049..3060 CDD:409353
I-set 3065..3148 CDD:400151
Ig strand A' 3068..3074 CDD:409353
Ig strand B 3081..3088 CDD:409353
Ig strand C 3093..3098 CDD:409353
Ig strand C' 3100..3103 CDD:409353
Ig strand E 3117..3124 CDD:409353
Ig strand G 3138..3149 CDD:409353
Ig 3159..3239 CDD:416386
Ig strand A' 3161..3165 CDD:409353
Ig strand B 3169..3175 CDD:409353
Ig strand C 3182..3187 CDD:409353
Ig strand C' 3190..3193 CDD:409353
Ig strand D 3198..3203 CDD:409353
Ig strand E 3206..3213 CDD:409353
Ig strand F 3222..3228 CDD:409353
Ig strand G 3231..3239 CDD:409353
Ig 3245..3335 CDD:416386
Ig strand A 3245..3247 CDD:409353
Ig strand A' 3249..3255 CDD:409353
Ig strand B 3262..3269 CDD:409353
Ig strand C 3275..3280 CDD:409353
Ig strand C' 3282..3285 CDD:409353
Ig strand D 3290..3294 CDD:409353
Ig strand E 3299..3306 CDD:409353
Ig strand F 3313..3321 CDD:409353
Ig strand G 3324..3335 CDD:409353
Ig strand A 3350..3353 CDD:409353
I-set 3351..3437 CDD:400151
Ig strand A' 3356..3360 CDD:409353
Ig strand B 3368..3376 CDD:409353
Ig strand C 3380..3385 CDD:409353
Ig strand C' 3388..3390 CDD:409353
Ig strand D 3396..3401 CDD:409353
Ig strand E 3404..3409 CDD:409353
Ig strand F 3418..3426 CDD:409353
Ig strand G 3429..3437 CDD:409353
I-set 3471..3562 CDD:400151
Ig strand A 3471..3473 CDD:409353
Ig strand A' 3475..3481 CDD:409353
Ig strand B 3488..3495 CDD:409353
Ig strand C 3501..3506 CDD:409353
Ig strand C' 3508..3511 CDD:409353
Ig strand D 3518..3522 CDD:409353
Ig strand E 3527..3534 CDD:409353
Ig strand F 3541..3549 CDD:409353
Ig strand G 3552..3562 CDD:409353
I-set 3634..3721 CDD:400151 13/86 (15%)
Ig strand A 3634..3637 CDD:409353 1/2 (50%)
Ig strand A' 3640..3645 CDD:409353 0/4 (0%)
Ig strand B 3650..3657 CDD:409353 0/6 (0%)
Ig strand C 3664..3670 CDD:409353 0/5 (0%)
Ig strand C' 3671..3674 CDD:409353 0/2 (0%)
Ig strand D 3679..3685 CDD:409353 1/5 (20%)
Ig strand E 3688..3698 CDD:409353 3/9 (33%)
Ig strand F 3702..3710 CDD:409353 1/7 (14%)
Ig strand G 3712..3723 CDD:409353 1/10 (10%)
I-set 3750..3840 CDD:400151 18/100 (18%)
Ig strand B 3765..3774 CDD:409353 3/16 (19%)
Ig strand C 3779..3785 CDD:409353 2/5 (40%)
Ig strand C' 3788..3790 CDD:409353 0/1 (0%)
Ig strand D 3796..3801 CDD:409353 0/4 (0%)
Ig strand E 3804..3812 CDD:409353 0/7 (0%)
Ig strand F 3820..3827 CDD:409353 1/6 (17%)
Ig strand G 3830..3840 CDD:409353 3/9 (33%)
Ig 4376..4463 CDD:416386 21/86 (24%)
Ig strand A 4376..4379 CDD:409353 1/2 (50%)
Ig strand A' 4382..4387 CDD:409353 3/4 (75%)
Ig strand B 4392..4399 CDD:409353 1/6 (17%)
Ig strand C 4404..4410 CDD:409353 0/5 (0%)
Ig strand C' 4411..4414 CDD:409353 0/2 (0%)
Ig strand D 4420..4426 CDD:409353 1/5 (20%)
Ig strand E 4429..4438 CDD:409353 0/8 (0%)
Ig strand F 4442..4450 CDD:409353 2/7 (29%)
Ig strand G 4452..4463 CDD:409353 4/10 (40%)
I-set 4469..4558 CDD:400151 23/120 (19%)
Ig strand A 4469..4471 CDD:409353 1/1 (100%)
Ig strand A' 4473..4479 CDD:409353 4/10 (40%)
Ig strand B 4486..4493 CDD:409353 1/6 (17%)
Ig strand C 4499..4504 CDD:409353 1/19 (5%)
Ig strand C' 4506..4509 CDD:409353 0/2 (0%)
Ig strand D 4514..4518 CDD:409353 0/4 (0%)
Ig strand E 4523..4530 CDD:409353 2/6 (33%)
Ig strand F 4537..4545 CDD:409353 1/7 (14%)
Ig strand G 4548..4558 CDD:409353 2/9 (22%)
I-set 4564..4653 CDD:400151 9/88 (10%)
Ig strand A 4564..4567 CDD:409353 0/2 (0%)
Ig strand A' 4570..4575 CDD:409353 0/4 (0%)
Ig strand B 4580..4587 CDD:409353 0/6 (0%)
Ig strand C 4594..4600 CDD:409353 0/5 (0%)
Ig strand C' 4601..4604 CDD:409353 1/2 (50%)
Ig strand D 4609..4615 CDD:409353 0/5 (0%)
Ig strand E 4618..4628 CDD:409353 1/9 (11%)
Ig strand F 4632..4640 CDD:409353 1/7 (14%)
Ig strand G 4642..4653 CDD:409353 0/10 (0%)
Ig 4657..4730 CDD:416386 24/85 (28%)
Ig strand B 4674..4678 CDD:409353 1/3 (33%)
Ig strand C 4687..4691 CDD:409353 1/3 (33%)
Ig strand E 4712..4716 CDD:409353 2/16 (13%)
Ig strand F 4726..4730 CDD:409353 3/3 (100%)
I-set 4750..4840 CDD:400151 32/107 (30%)
Ig strand B 4768..4772 CDD:409353 1/3 (33%)
Ig strand C 4781..4785 CDD:409353 1/3 (33%)
Ig strand E 4806..4810 CDD:409353 1/8 (13%)
Ig strand F 4820..4825 CDD:409353 4/4 (100%)
I-set 4844..4930 CDD:400151 18/96 (19%)
Ig strand B 4861..4865 CDD:409353 1/3 (33%)
Ig strand C 4874..4878 CDD:409353 1/4 (25%)
Ig strand E 4899..4903 CDD:409353 1/3 (33%)
Ig strand F 4913..4918 CDD:409353 2/4 (50%)
I-set 4937..5026 CDD:400151 26/89 (29%)
Ig strand A 4937..4939 CDD:409353 1/1 (100%)
Ig strand A' 4942..4947 CDD:409353 0/4 (0%)
Ig strand B 4954..4962 CDD:409353 1/7 (14%)
Ig strand C 4967..4971 CDD:409353 1/3 (33%)
Ig strand C' 4975..4977 CDD:409353 1/1 (100%)
Ig strand D 4982..4988 CDD:409353 1/5 (20%)
Ig strand E 4991..4996 CDD:409353 1/5 (20%)
Ig strand F 5005..5013 CDD:409353 4/7 (57%)
Ig strand G 5016..5027 CDD:409353 3/10 (30%)
I-set 5039..5119 CDD:400151 14/79 (18%)
Ig strand B 5047..5051 CDD:409353 0/3 (0%)
Ig strand C 5060..5064 CDD:409353 0/3 (0%)
Ig strand E 5085..5089 CDD:409353 0/3 (0%)
Ig strand F 5099..5104 CDD:409353 0/4 (0%)
Ig strand G 5113..5116 CDD:409353 0/2 (0%)
I-set 5126..5215 CDD:400151 9/88 (10%)
Ig strand B 5144..5147 CDD:409353 0/2 (0%)
Ig strand C 5156..5160 CDD:409353 0/3 (0%)
Ig strand E 5181..5185 CDD:409353 0/3 (0%)
Ig strand F 5195..5200 CDD:409353 1/4 (25%)
Ig strand G 5209..5212 CDD:409353 0/2 (0%)
Ig strand A 5218..5221 CDD:409353 1/2 (50%)
I-set 5219..5308 CDD:400151 19/99 (19%)
Ig strand A' 5224..5228 CDD:409353 1/3 (33%)
Ig strand B 5236..5244 CDD:409353 0/7 (0%)
Ig strand C 5249..5254 CDD:409353 2/14 (14%)
Ig strand C' 5257..5259 CDD:409353 0/1 (0%)
Ig strand D 5265..5270 CDD:409353 1/5 (20%)
Ig strand E 5273..5278 CDD:409353 1/4 (25%)
Ig strand F 5287..5295 CDD:409353 4/7 (57%)
Ig strand G 5298..5308 CDD:409353 4/9 (44%)
I-set 5314..5402 CDD:400151 21/90 (23%)
Ig strand A' 5318..5323 CDD:409353 1/4 (25%)
Ig strand B 5329..5336 CDD:409353 1/6 (17%)
Ig strand C 5343..5349 CDD:409353 1/5 (20%)
Ig strand C' 5350..5353 CDD:409353 0/2 (0%)
Ig strand D 5359..5365 CDD:409353 0/5 (0%)
Ig strand E 5368..5377 CDD:409353 2/9 (22%)
Ig strand F 5381..5389 CDD:409353 3/7 (43%)
I-set 5406..5494 CDD:400151 27/92 (29%)
Ig strand B 5423..5427 CDD:409353 1/3 (33%)
Ig strand C 5436..5440 CDD:409353 1/3 (33%)
Ig strand E 5461..5465 CDD:409353 0/3 (0%)
Ig strand F 5475..5480 CDD:409353 1/4 (25%)
Ig 5499..5588 CDD:416386 20/114 (18%)
Ig strand C 5529..5533 CDD:409353 0/3 (0%)
Ig strand E 5554..5558 CDD:409353 1/3 (33%)
Ig strand F 5568..5573 CDD:409353 1/4 (25%)
Ig 5600..5681 CDD:416386 25/96 (26%)
Ig strand A 5601..5604 CDD:409353 1/2 (50%)
Ig strand B 5609..5615 CDD:409353 1/5 (20%)
Ig strand C 5621..5627 CDD:409353 0/5 (0%)
Ig strand D 5639..5644 CDD:409353 1/4 (25%)
Ig strand E 5645..5651 CDD:409353 1/12 (8%)
Ig strand F 5660..5668 CDD:409353 3/7 (43%)
Ig strand G 5671..5681 CDD:409353 1/9 (11%)
I-set 5688..5777 CDD:400151 22/99 (22%)
Ig strand C 5718..5722 CDD:409353 0/3 (0%)
Ig strand E 5743..5747 CDD:409353 1/3 (33%)
Ig strand F 5757..5762 CDD:409353 2/4 (50%)
Ig strand A 5780..5783 CDD:409353 1/2 (50%)
Ig 5781..5870 CDD:416386 31/102 (30%)
Ig strand A' 5786..5790 CDD:409353 1/3 (33%)
Ig strand B 5798..5806 CDD:409353 4/7 (57%)
Ig strand C 5811..5816 CDD:409353 3/4 (75%)
Ig strand C' 5819..5821 CDD:409353 1/1 (100%)
Ig strand D 5827..5832 CDD:409353 0/4 (0%)
Ig strand E 5835..5840 CDD:409353 1/4 (25%)
Ig strand F 5849..5857 CDD:409353 3/7 (43%)
Ig strand G 5860..5870 CDD:409353 2/10 (20%)
I-set 5874..5964 CDD:400151 29/92 (32%)
Ig strand B 5893..5896 CDD:409353 0/2 (0%)
Ig strand C 5905..5909 CDD:409353 1/3 (33%)
Ig strand E 5930..5934 CDD:409353 0/3 (0%)
Ig strand F 5944..5949 CDD:409353 1/4 (25%)
Ig strand G 5957..5960 CDD:409353 1/2 (50%)
I-set 5968..6056 CDD:400151 25/88 (28%)
Ig strand A 5968..5970 CDD:409353 1/1 (100%)
Ig strand A' 5972..5978 CDD:409353 0/5 (0%)
Ig strand B 5985..5992 CDD:409353 2/6 (33%)
Ig strand C 5998..6003 CDD:409353 3/4 (75%)
Ig strand C' 6005..6008 CDD:409353 0/2 (0%)
Ig strand D 6013..6017 CDD:409353 0/4 (0%)
Ig strand E 6022..6029 CDD:409353 2/6 (33%)
Ig strand F 6036..6044 CDD:409353 4/7 (57%)
Ig strand G 6047..6058 CDD:409353 2/13 (15%)
I-set 6061..6150 CDD:400151 20/91 (22%)
Ig strand B 6078..6082 CDD:409353 0/3 (0%)
Ig strand C 6091..6095 CDD:409353 0/3 (0%)
Ig strand E 6116..6120 CDD:409353 1/3 (33%)
Ig strand F 6130..6135 CDD:409353 1/4 (25%)
I-set 6155..6243 CDD:400151 24/89 (27%)
Ig strand B 6171..6175 CDD:409353 1/3 (33%)
Ig strand C 6184..6188 CDD:409353 1/3 (33%)
Ig strand E 6209..6213 CDD:409353 0/3 (0%)
Ig strand F 6223..6228 CDD:409353 2/4 (50%)
Ig strand A 6249..6252 CDD:409353 2/2 (100%)
I-set 6250..6339 CDD:400151 27/88 (31%)
Ig strand A' 6255..6259 CDD:409353 1/3 (33%)
Ig strand B 6267..6275 CDD:409353 1/7 (14%)
Ig strand C 6280..6285 CDD:409353 1/4 (25%)
Ig strand C' 6288..6290 CDD:409353 1/1 (100%)
Ig strand D 6296..6301 CDD:409353 1/4 (25%)
Ig strand E 6304..6309 CDD:409353 1/4 (25%)
Ig strand F 6318..6326 CDD:409353 2/7 (29%)
Ig strand G 6329..6339 CDD:409353 3/9 (33%)
Ig strand A 6342..6345 CDD:409353 2/2 (100%)
I-set 6343..6432 CDD:400151 24/89 (27%)
Ig strand A' 6348..6352 CDD:409353 1/3 (33%)
Ig strand B 6360..6368 CDD:409353 2/7 (29%)
Ig strand C 6373..6378 CDD:409353 1/4 (25%)
Ig strand C' 6381..6383 CDD:409353 0/1 (0%)
Ig strand D 6389..6394 CDD:409353 1/4 (25%)
Ig strand E 6397..6402 CDD:409353 1/5 (20%)
Ig strand F 6411..6419 CDD:409353 3/7 (43%)
Ig strand G 6422..6432 CDD:409353 4/9 (44%)
I-set 6436..6526 CDD:400151 11/89 (12%)
Ig strand A 6436..6439 CDD:409353 0/2 (0%)
Ig strand A' 6442..6447 CDD:409353 1/4 (25%)
Ig strand B 6453..6460 CDD:409353 0/6 (0%)
Ig strand C 6467..6473 CDD:409353 0/5 (0%)
Ig strand C' 6474..6477 CDD:409353 1/2 (50%)
Ig strand D 6483..6489 CDD:409353 1/5 (20%)
Ig strand E 6491..6501 CDD:409353 0/9 (0%)
Ig strand F 6505..6513 CDD:409353 2/7 (29%)
Ig strand G 6515..6526 CDD:409353 0/10 (0%)
I-set 6530..6618 CDD:400151 15/96 (16%)
Ig strand B 6547..6551 CDD:409353 0/3 (0%)
Ig strand C 6560..6564 CDD:409353 1/3 (33%)
Ig strand E 6585..6589 CDD:409353 0/3 (0%)
Ig strand F 6599..6604 CDD:409353 0/4 (0%)
Ig strand A 6622..6626 CDD:409353 0/3 (0%)
I-set 6623..6713 CDD:400151 8/104 (8%)
Ig strand A' 6631..6635 CDD:409353 0/3 (0%)
Ig strand B 6639..6648 CDD:409353 0/8 (0%)
Ig strand C 6652..6658 CDD:409353 0/5 (0%)
Ig strand C' 6661..6664 CDD:409353 0/2 (0%)
Ig strand D 6670..6675 CDD:409353 0/4 (0%)
Ig strand E 6679..6684 CDD:409353 0/4 (0%)
Ig strand F 6692..6700 CDD:409353 1/7 (14%)
Ig strand G 6703..6713 CDD:409353 4/24 (17%)
I-set 6718..6806 CDD:400151 9/90 (10%)
Ig strand C 6747..6751 CDD:409353 1/3 (33%)
Ig strand E 6772..6776 CDD:409353 0/3 (0%)
Ig strand F 6786..6791 CDD:409353 1/4 (25%)
Ig strand G 6800..6803 CDD:409353 0/2 (0%)
I-set 6813..6902 CDD:400151 25/90 (28%)
Ig strand C 6843..6847 CDD:409353 0/3 (0%)
Ig strand E 6868..6872 CDD:409353 2/3 (67%)
Ig strand F 6882..6887 CDD:409353 1/4 (25%)
Ig strand A 6905..6908 CDD:409353 1/2 (50%)
I-set 6906..6995 CDD:400151 22/89 (25%)
Ig strand A' 6914..6917 CDD:409353 0/2 (0%)
Ig strand B 6922..6930 CDD:409353 1/7 (14%)
Ig strand C 6936..6940 CDD:409353 1/3 (33%)
Ig strand C' 6943..6946 CDD:409353 0/2 (0%)
Ig strand D 6951..6957 CDD:409353 2/6 (33%)
Ig strand E 6961..6966 CDD:409353 1/4 (25%)
Ig strand F 6974..6982 CDD:409353 2/7 (29%)
Ig strand G 6985..6995 CDD:409353 2/9 (22%)
I-set 7001..7086 CDD:400151 8/84 (10%)
Ig strand B 7016..7020 CDD:409353 0/3 (0%)
Ig strand C 7029..7033 CDD:409353 0/3 (0%)
Ig strand E 7054..7058 CDD:409353 0/3 (0%)
Ig strand F 7068..7073 CDD:409353 0/4 (0%)
I-set 7092..7173 CDD:400151 11/81 (14%)
Ig strand B 7109..7113 CDD:409353 0/3 (0%)
Ig strand C 7122..7126 CDD:409353 0/3 (0%)
Ig strand E 7147..7151 CDD:409353 0/4 (0%)
Ig strand F 7161..7166 CDD:409353 0/4 (0%)
Ig strand G 7175..7178 CDD:409353 1/2 (50%)
I-set 7188..7276 CDD:400151 17/89 (19%)
Ig strand B 7205..7209 CDD:409353 3/3 (100%)
Ig strand C 7218..7222 CDD:409353 0/3 (0%)
Ig strand E 7243..7247 CDD:409353 0/3 (0%)
Ig strand F 7257..7262 CDD:409353 0/4 (0%)
I-set 7284..7373 CDD:400151 28/120 (23%)
Ig strand A 7284..7287 CDD:409353 0/2 (0%)
Ig strand A' 7290..7295 CDD:409353 1/4 (25%)
Ig strand B 7300..7307 CDD:409353 2/10 (20%)
Ig strand C 7314..7320 CDD:409353 1/5 (20%)
Ig strand C' 7321..7324 CDD:409353 2/2 (100%)
Ig strand D 7330..7336 CDD:409353 3/16 (19%)
Ig strand E 7339..7348 CDD:409353 3/16 (19%)
Ig strand F 7352..7360 CDD:409353 0/7 (0%)
Ig strand G 7362..7373 CDD:409353 4/10 (40%)
Ig strand A 7376..7379 CDD:409353 1/2 (50%)
I-set 7377..7467 CDD:400151 12/90 (13%)
Ig strand A' 7382..7386 CDD:409353 1/3 (33%)
Ig strand B 7395..7403 CDD:409353 1/8 (13%)
Ig strand C 7408..7413 CDD:409353 0/4 (0%)
Ig strand C' 7416..7418 CDD:409353 0/1 (0%)
Ig strand D 7424..7429 CDD:409353 2/4 (50%)
Ig strand E 7432..7437 CDD:409353 0/4 (0%)
Ig strand F 7446..7454 CDD:409353 1/7 (14%)
Ig strand G 7457..7467 CDD:409353 0/9 (0%)
Ig strand A 7470..7473 CDD:409353 2/4 (50%)
I-set 7471..7559 CDD:400151 17/93 (18%)
Ig strand A' 7476..7480 CDD:409353 1/5 (20%)
Ig strand B 7488..7496 CDD:409353 0/7 (0%)
Ig strand C 7501..7506 CDD:409353 0/4 (0%)
Ig strand C' 7509..7511 CDD:409353 0/1 (0%)
Ig strand D 7517..7522 CDD:409353 0/4 (0%)
Ig strand E 7525..7530 CDD:409353 1/4 (25%)
Ig strand F 7539..7547 CDD:409353 1/7 (14%)
Ig strand A 7563..7567 CDD:409353 0/3 (0%)
I-set 7564..7654 CDD:400151 22/105 (21%)
Ig strand A' 7572..7576 CDD:409353 1/3 (33%)
Ig strand B 7580..7589 CDD:409353 4/11 (36%)
Ig strand C 7593..7599 CDD:409353 3/10 (30%)
Ig strand C' 7602..7605 CDD:409353 0/2 (0%)
Ig strand D 7611..7616 CDD:409353 0/4 (0%)
Ig strand E 7620..7625 CDD:409353 1/4 (25%)
Ig strand F 7633..7641 CDD:409353 0/7 (0%)
Ig strand G 7644..7660 CDD:409353 5/23 (22%)
Ig strand A 7657..7664 CDD:409353 2/6 (33%)
I-set 7660..7747 CDD:400151 23/87 (26%)
Ig strand A' 7665..7670 CDD:409353 0/4 (0%)
Ig strand B 7675..7683 CDD:409353 1/7 (14%)
Ig strand C 7687..7693 CDD:409353 1/5 (20%)
Ig strand C' 7695..7697 CDD:409353 0/1 (0%)
Ig strand D 7703..7709 CDD:409353 2/5 (40%)
Ig strand E 7712..7718 CDD:409353 2/6 (33%)
Ig strand F 7727..7734 CDD:409353 1/6 (17%)
Ig strand A 7753..7756 CDD:409353 1/2 (50%)
I-set 7754..7843 CDD:400151 19/90 (21%)
Ig strand A' 7759..7763 CDD:409353 0/3 (0%)
Ig strand B 7771..7779 CDD:409353 1/7 (14%)
Ig strand C 7784..7789 CDD:409353 1/4 (25%)
Ig strand C' 7792..7794 CDD:409353 0/1 (0%)
Ig strand D 7800..7805 CDD:409353 0/4 (0%)
Ig strand E 7808..7813 CDD:409353 1/4 (25%)
Ig strand F 7822..7830 CDD:409353 4/7 (57%)
Ig strand G 7833..7843 CDD:409353 2/9 (22%)
Ig strand A 7846..7849 CDD:409353 0/2 (0%)
I-set 7847..7936 CDD:400151 15/100 (15%)
Ig strand A' 7852..7856 CDD:409353 0/3 (0%)
Ig strand B 7864..7872 CDD:409353 1/7 (14%)
Ig strand C 7877..7882 CDD:409353 1/8 (13%)
Ig strand C' 7885..7887 CDD:409353 0/1 (0%)
Ig strand D 7893..7898 CDD:409353 1/4 (25%)
Ig strand E 7901..7906 CDD:409353 1/4 (25%)
Ig strand F 7915..7923 CDD:409353 3/7 (43%)
Ig strand G 7926..7936 CDD:409353 0/9 (0%)
Ig 7942..8029 CDD:416386 16/88 (18%)
Ig strand A' 7944..7950 CDD:409353 1/5 (20%)
Ig strand B 7957..7964 CDD:409353 1/6 (17%)
Ig strand C 7970..7975 CDD:409353 0/4 (0%)
Ig strand C' 7977..7980 CDD:409353 0/2 (0%)
Ig strand D 7985..7989 CDD:409353 0/3 (0%)
Ig strand E 7994..8001 CDD:409353 1/6 (17%)
Ig strand F 8008..8016 CDD:409353 0/7 (0%)
Ig strand G 8019..8029 CDD:409353 2/9 (22%)
I-set 8033..8122 CDD:400151 4/13 (31%)
Ig strand B 8050..8054 CDD:409353
Ig strand C 8063..8067 CDD:409353
Ig strand E 8088..8092 CDD:409353
Ig strand F 8102..8107 CDD:409353
Ig strand G 8116..8119 CDD:409353
I-set 8129..8217 CDD:400151
Ig strand B 8146..8150 CDD:409353
Ig strand C 8159..8163 CDD:409353
Ig strand E 8184..8188 CDD:409353
Ig strand F 8198..8203 CDD:409353
I-set 8225..8314 CDD:400151
Ig strand A 8225..8228 CDD:409353
Ig strand A' 8231..8236 CDD:409353
Ig strand B 8241..8248 CDD:409353
Ig strand C 8255..8261 CDD:409353
Ig strand C' 8262..8265 CDD:409353
Ig strand D 8271..8277 CDD:409353
Ig strand E 8279..8289 CDD:409353
Ig strand F 8293..8301 CDD:409353
Ig strand G 8303..8314 CDD:409353
Ig 8318..8395 CDD:416386
Ig strand C 8349..8353 CDD:409353
Ig strand E 8374..8378 CDD:409353
Ig strand F 8388..8393 CDD:409353
Ig strand A 8411..8414 CDD:409353
I-set 8412..8500 CDD:400151
Ig strand A' 8417..8421 CDD:409353
Ig strand B 8429..8437 CDD:409353
Ig strand C 8442..8447 CDD:409353
Ig strand C' 8450..8452 CDD:409353
Ig strand D 8458..8463 CDD:409353
Ig strand E 8466..8471 CDD:409353
Ig strand F 8480..8488 CDD:409353
Ig strand A 8504..8507 CDD:409353
I-set 8505..8595 CDD:400151
Ig strand A' 8510..8514 CDD:409353
Ig strand B 8522..8530 CDD:409353
Ig strand C 8535..8540 CDD:409353
Ig strand C' 8543..8545 CDD:409353
Ig strand D 8552..8557 CDD:409353
Ig strand E 8560..8565 CDD:409353
Ig strand F 8574..8582 CDD:409353
Ig strand G 8585..8595 CDD:409353
I-set 8601..8688 CDD:400151
Ig strand B 8617..8620 CDD:409353
Ig strand C 8629..8633 CDD:409353
Ig strand E 8654..8658 CDD:409353
Ig strand F 8668..8673 CDD:409353
Ig strand A 8694..8697 CDD:409353
I-set 8695..8784 CDD:400151
Ig strand A' 8700..8704 CDD:409353
Ig strand B 8712..8720 CDD:409353
Ig strand C 8725..8730 CDD:409353
Ig strand C' 8733..8735 CDD:409353
Ig strand D 8741..8746 CDD:409353
Ig strand E 8749..8754 CDD:409353
Ig strand F 8763..8771 CDD:409353
Ig strand G 8774..8784 CDD:409353
I-set 8788..8877 CDD:400151
Ig strand B 8805..8809 CDD:409353
Ig strand C 8818..8822 CDD:409353
Ig strand E 8843..8847 CDD:409353
Ig strand F 8857..8862 CDD:409353
I-set 8883..8967 CDD:400151
Ig strand A 8890..8893 CDD:409353
Ig strand B 8898..8904 CDD:409353
Ig strand C 8910..8916 CDD:409353
Ig strand D 8928..8933 CDD:409353
Ig strand E 8934..8940 CDD:409353
Ig strand F 8949..8957 CDD:409353
I-set 8974..9063 CDD:400151
Ig strand B 8991..8995 CDD:409353
Ig strand C 9004..9008 CDD:409353
Ig strand E 9029..9033 CDD:409353
Ig strand F 9043..9048 CDD:409353
Ig strand G 9057..9060 CDD:409353
Ig strand A 9069..9072 CDD:409353
I-set 9070..9158 CDD:400151
Ig strand A' 9075..9079 CDD:409353
Ig strand B 9087..9095 CDD:409353
Ig strand C 9100..9105 CDD:409353
Ig strand C' 9108..9110 CDD:409353
Ig strand D 9116..9121 CDD:409353
Ig strand E 9124..9129 CDD:409353
Ig strand F 9138..9146 CDD:409353
Ig strand G 9149..9159 CDD:409353
I-set 9166..9255 CDD:400151
Ig strand B 9183..9187 CDD:409353
Ig strand C 9196..9200 CDD:409353
Ig strand E 9221..9225 CDD:409353
Ig strand F 9235..9240 CDD:409353
Ig strand G 9248..9251 CDD:409353
Ig 9262..9352 CDD:416386
Ig strand A 9262..9264 CDD:409353
Ig strand A' 9266..9271 CDD:409353
Ig strand B 9280..9287 CDD:409353
Ig strand C 9293..9298 CDD:409353
Ig strand C' 9300..9303 CDD:409353
Ig strand D 9308..9312 CDD:409353
Ig strand E 9317..9324 CDD:409353
Ig strand F 9331..9339 CDD:409353
Ig strand G 9342..9353 CDD:409353
Ig strand A 9358..9361 CDD:409353
I-set 9359..9448 CDD:400151
Ig strand A' 9364..9368 CDD:409353
Ig strand B 9376..9384 CDD:409353
Ig strand C 9389..9394 CDD:409353
Ig strand C' 9397..9399 CDD:409353
Ig strand D 9405..9410 CDD:409353
Ig strand E 9413..9418 CDD:409353
Ig strand F 9427..9435 CDD:409353
Ig strand G 9438..9448 CDD:409353
I-set 9469..9557 CDD:400151
Ig strand A' 9471..9477 CDD:409353
Ig strand B 9484..9491 CDD:409353
Ig strand C 9497..9502 CDD:409353
Ig strand D 9513..9517 CDD:409353
Ig strand E 9522..9529 CDD:409353
Ig strand F 9536..9544 CDD:409353
Ig strand G 9547..9557 CDD:409353
THB 9591..9621 CDD:408162
Ig 9675..9755 CDD:416386
Ig strand C 9700..9704 CDD:409353
Ig strand E 9725..9729 CDD:409353
Ig 9758..9840 CDD:416386
Ig strand A 9758..9761 CDD:409353
Ig strand A' 9764..9769 CDD:409353
Ig strand B 9774..9781 CDD:409353
Ig strand C 9787..9793 CDD:409353
Ig strand C' 9794..9797 CDD:409353
Ig strand D 9803..9808 CDD:409353
Ig strand E 9811..9821 CDD:409353
Ig strand G 9831..9842 CDD:409353
I-set 9848..9934 CDD:400151
Ig strand A' 9851..9857 CDD:409353
Ig strand B 9864..9871 CDD:409353
Ig strand C 9876..9881 CDD:409353
Ig strand C' 9883..9886 CDD:409353
Ig strand D 9891..9895 CDD:409353
Ig strand E 9900..9907 CDD:409353
Ig strand F 9914..9923 CDD:409353
PTZ00121 <10208..10736 CDD:173412
PPAK 11006..11030 CDD:397106
PPAK 11062..11086 CDD:397106
PPAK 11088..11114 CDD:397106
PPAK 11264..11288 CDD:397106
PTZ00449 <11550..11841 CDD:185628
PHA03247 <11702..12305 CDD:223021
PspC_subgroup_2 <12149..12512 CDD:411408
PPAK 12629..12654 CDD:397106
Ig 13103..13194 CDD:416386
Ig strand B 13123..13127 CDD:409353
Ig strand C 13136..13139 CDD:409353
Ig strand E 13160..13164 CDD:409353
Ig strand F 13174..13179 CDD:409353
Ig_3 13207..13275 CDD:404760
IG_like 13300..>13364 CDD:214653
Ig 13475..13557 CDD:416386
Ig strand A' 13481..13484 CDD:409353
Ig strand B 13488..13497 CDD:409353
Ig strand C' 13509..13511 CDD:409353
Ig strand D 13517..13522 CDD:409353
Ig strand E 13525..13532 CDD:409353
Ig strand A 13561..13563 CDD:409353
Ig 13562..13645 CDD:416386
Ig strand A' 13565..13571 CDD:409353
Ig strand B 13578..13585 CDD:409353
Ig strand C 13590..13595 CDD:409353
Ig strand C' 13597..13600 CDD:409353
Ig strand D 13605..13609 CDD:409353
Ig strand E 13614..13621 CDD:409353
Ig strand F 13628..13636 CDD:409353
Ig 13650..13733 CDD:416386
Ig strand B 13666..13672 CDD:409353
Ig strand C 13678..13683 CDD:409353
Ig strand C' 13686..13689 CDD:409353
Ig strand D 13694..13699 CDD:409353
Ig strand E 13702..13707 CDD:409353
Ig strand F 13716..13722 CDD:409353
Ig strand G 13725..13733 CDD:409353
Ig 13739..13822 CDD:416386
Ig strand B 13755..13762 CDD:409353
Ig strand C 13767..13772 CDD:409353
Ig strand C' 13774..13777 CDD:409353
Ig strand D 13782..13786 CDD:409353
Ig strand E 13791..13798 CDD:409353
Ig strand F 13805..13813 CDD:409353
Ig strand G 13814..13823 CDD:409353
Ig strand A 13826..13828 CDD:409353
Ig 13829..13903 CDD:416386
Ig strand A' 13830..13837 CDD:409353
Ig strand B 13844..13851 CDD:409353
Ig strand C 13856..13861 CDD:409353
Ig strand C' 13863..13866 CDD:409353
Ig strand D 13871..13875 CDD:409353
Ig strand E 13880..13887 CDD:409353
Ig strand F 13894..13902 CDD:409353
Ig strand A 13916..13918 CDD:409353
Ig 13917..14000 CDD:416386
Ig strand A' 13920..13926 CDD:409353
Ig strand B 13933..13940 CDD:409353
Ig strand C 13946..13950 CDD:409353
Ig strand D 13960..13964 CDD:409353
Ig strand E 13969..13976 CDD:409353
Ig strand F 13983..13991 CDD:409353
Ig 14005..14089 CDD:416386
Ig strand A' 14010..14014 CDD:409353
Ig strand B 14022..14030 CDD:409353
Ig strand C 14035..14039 CDD:409353
Ig strand C' 14042..14044 CDD:409353
Ig strand D 14050..14055 CDD:409353
Ig strand E 14058..14063 CDD:409353
Ig strand G 14079..14089 CDD:409353
Ig 14095..14178 CDD:416386
Ig 14186..14257 CDD:416386
Ig strand A' 14192..14195 CDD:409353
Ig strand B 14199..14205 CDD:409353
Ig strand C 14212..14217 CDD:409353
Ig strand C' 14220..14223 CDD:409353
Ig strand D 14228..14233 CDD:409353
Ig strand E 14236..14241 CDD:409353
Ig strand F 14250..14256 CDD:409353
Ig strand G 14259..14267 CDD:409353
Ig 14273..14356 CDD:416386
Ig strand A' 14276..14282 CDD:409353
Ig strand B 14289..14296 CDD:409353
Ig strand C 14301..14306 CDD:409353
Ig strand C' 14308..14311 CDD:409353
Ig strand D 14316..14320 CDD:409353
Ig strand E 14325..14332 CDD:409353
Ig strand F 14339..14347 CDD:409353
Ig 14362..14433 CDD:416386
Ig strand A' 14365..14371 CDD:409353
Ig strand B 14378..14385 CDD:409353
Ig strand C 14390..14395 CDD:409353
Ig strand C' 14397..14400 CDD:409353
Ig strand D 14405..14409 CDD:409353
Ig strand E 14414..14421 CDD:409353
IG_like 14458..14522 CDD:214653
Ig strand B 14466..14472 CDD:409353
Ig strand C 14479..14484 CDD:409353
Ig strand C' 14487..14490 CDD:409353
Ig strand D 14495..14500 CDD:409353
Ig strand E 14503..14508 CDD:409353
Ig strand F 14517..14523 CDD:409353
Ig strand G 14526..14534 CDD:409353
Ig 14540..14623 CDD:416386
Ig strand A 14542..14545 CDD:409353
Ig strand A' 14547..14551 CDD:409353
Ig strand B 14554..14563 CDD:409353
Ig strand C 14568..14573 CDD:409353
Ig strand C' 14576..14579 CDD:409353
Ig strand D 14583..14588 CDD:409353
Ig strand E 14589..14599 CDD:409353
Ig strand G 14613..14623 CDD:409353
Ig 14629..14717 CDD:416386
Ig strand A' 14631..14637 CDD:409353
Ig strand B 14644..14651 CDD:409353
Ig strand C 14656..14661 CDD:409353
Ig strand C' 14663..14666 CDD:409353
Ig strand D 14671..14675 CDD:409353
Ig strand E 14680..14687 CDD:409353
Ig strand F 14694..14702 CDD:409353
Ig strand G 14705..14717 CDD:409353
Ig 14722..14805 CDD:416386
Ig strand A' 14727..14732 CDD:409353
Ig strand B 14737..14744 CDD:409353
Ig strand C 14750..14756 CDD:409353
Ig strand C' 14757..14760 CDD:409353
Ig strand D 14766..14772 CDD:409353
Ig strand E 14774..14784 CDD:409353
Ig strand G 14795..14805 CDD:409353
Ig 14811..14894 CDD:416386
Ig strand A' 14814..14820 CDD:409353
Ig strand B 14827..14834 CDD:409353
Ig strand C 14839..14844 CDD:409353
Ig strand C' 14846..14849 CDD:409353
Ig strand D 14854..14858 CDD:409353
Ig strand E 14863..14870 CDD:409353
Ig strand F 14877..14885 CDD:409353
Ig 14900..14982 CDD:416386
Ig 14996..15073 CDD:416386
Ig strand A 14996..14999 CDD:409353
Ig strand B 15004..15010 CDD:409353
Ig strand C 15016..15022 CDD:409353
Ig strand D 15031..15036 CDD:409353
Ig strand E 15037..15043 CDD:409353
Ig strand F 15052..15060 CDD:409353
Ig strand G 15063..15073 CDD:409353
FN3 15077..15165 CDD:238020
FN3 15178..15270 CDD:238020
FN3 15279..15366 CDD:238020
Ig 15397..15471 CDD:416386
Ig strand B 15399..15405 CDD:409353
Ig strand C 15411..15417 CDD:409353
Ig strand D 15429..15434 CDD:409353
Ig strand E 15435..15441 CDD:409353
Ig strand F 15450..15458 CDD:409353
Ig strand G 15461..15471 CDD:409353
FN3 15475..15564 CDD:238020
FN3 15575..15664 CDD:238020
Ig 15687..15767 CDD:416386
Ig strand A 15687..15690 CDD:409353
Ig strand B 15695..15701 CDD:409353
Ig strand C 15707..15713 CDD:409353
Ig strand F 31103..31111 CDD:409353
Ig strand G 31114..31124 CDD:409353
FN3 31128..31219 CDD:238020
FN3 31227..31320 CDD:238020
FN3 31329..31419 CDD:238020
Ig_Titin_like 31442..31521 CDD:409406
Ig strand B 31451..31455 CDD:409406
Ig strand C 31464..31468 CDD:409406
Ig strand E 31487..31491 CDD:409406
Ig strand F 31501..31506 CDD:409406
Ig strand G 31514..31517 CDD:409406
FN3 31525..31616 CDD:238020
FN3 31622..31715 CDD:238020
Ig_Titin_like 31734..31815 CDD:409406
Ig strand B 31743..31747 CDD:409406
Ig strand C 31756..31760 CDD:409406
Ig strand E 31781..31785 CDD:409406
Ig strand F 31795..31800 CDD:409406
Ig strand G 31808..31811 CDD:409406
FN3 31819..31910 CDD:238020
FN3 31919..32012 CDD:238020
FN3 32020..32107 CDD:238020
Ig_Titin_like 32133..32211 CDD:409406
Ig strand B 32141..32145 CDD:409406
Ig strand C 32154..32158 CDD:409406
Ig strand E 32177..32181 CDD:409406
Ig strand F 32191..32196 CDD:409406
Ig strand D 15725..15730 CDD:409353
Ig strand E 15731..15737 CDD:409353
Ig strand F 15746..15754 CDD:409353
Ig strand G 15757..15767 CDD:409353
FN3 15771..15862 CDD:238020
FN3 15870..15962 CDD:238020
FN3 15971..16059 CDD:238020
FN3 16071..16157 CDD:238020
FN3 16171..16262 CDD:238020
FN3 16272..16363 CDD:238020
Ig 16383..16463 CDD:416386
Ig strand A 16383..16386 CDD:409353
Ig strand B 16391..16397 CDD:409353
Ig strand C 16403..16409 CDD:409353
Ig strand D 16421..16426 CDD:409353
Ig strand E 16427..16433 CDD:409353
Ig strand F 16442..16450 CDD:409353
Ig strand G 16453..16463 CDD:409353
FN3 16467..16553 CDD:238020
FN3 16572..16659 CDD:238020
Ig 16678..16785 CDD:416386
Ig strand B 16684..16690 CDD:409353
Ig strand C 16696..16702 CDD:409353
Ig strand D 16742..16747 CDD:409353
Ig strand E 16748..16755 CDD:409353
Ig strand F 16764..16772 CDD:409353
Ig strand G 16775..16785 CDD:409353
FN3 16789..16880 CDD:238020
FN3 16890..16982 CDD:238020
FN3 16996..17082 CDD:238020
Ig 17105..17180 CDD:416386
Ig strand B 17109..17115 CDD:409353
Ig strand C 17121..17127 CDD:409353
Ig strand D 17138..17143 CDD:409353
Ig strand E 17144..17150 CDD:409353
Ig strand F 17159..17167 CDD:409353
Ig strand G 17170..17180 CDD:409353
FN3 17184..17273 CDD:238020
FN3 17282..17374 CDD:238020
Ig 17394..17481 CDD:416386
Ig strand A 17394..17398 CDD:409353
Ig strand B 17403..17409 CDD:409353
Ig strand C 17415..17421 CDD:409353
Ig strand D 17434..17439 CDD:409353
Ig strand E 17440..17451 CDD:409353
Ig strand F 17460..17468 CDD:409353
Ig strand G 17471..17481 CDD:409353
FN3 17485..17569 CDD:214495
FN3 17586..17680 CDD:238020
FN3 17692..17783 CDD:238020
Ig_Titin_like 17806..17895 CDD:409406
Ig strand B 17815..17819 CDD:409406
Ig strand C 17828..17832 CDD:409406
Ig strand E 17861..17865 CDD:409406
Ig strand F 17875..17880 CDD:409406
Ig strand G 17888..17891 CDD:409406
FN3 17899..17991 CDD:238020
FN3 18004..18093 CDD:238020
Ig 18115..18200 CDD:416386
Ig strand B 18121..18127 CDD:409353
Ig strand C 18133..18144 CDD:409353
Ig strand D 18158..18163 CDD:409353
Ig strand E 18164..18170 CDD:409353
Ig strand F 18179..18187 CDD:409353
Ig strand G 18190..18200 CDD:409353
FN3 18204..18296 CDD:238020
FN3 18304..18401 CDD:238020
FN3 18415..18500 CDD:238020
Ig_Titin_like 18520..18599 CDD:409406
Ig strand B 18529..18533 CDD:409406
Ig strand C 18542..18546 CDD:409406
Ig strand E 18565..18569 CDD:409406
Ig strand F 18579..18584 CDD:409406
Ig strand G 18592..18595 CDD:409406
FN3 18603..18691 CDD:238020
FN3 18704..18797 CDD:238020
Ig 18815..18895 CDD:416386
Ig strand A 18815..18818 CDD:409353
Ig strand B 18823..18829 CDD:409353
Ig strand C 18835..18841 CDD:409353
Ig strand D 18853..18858 CDD:409353
Ig strand E 18859..18865 CDD:409353
Ig strand F 18874..18882 CDD:409353
Ig strand G 18885..18895 CDD:409353
FN3 18899..18991 CDD:238020
FN3 18999..19088 CDD:238020
FN3 19100..19188 CDD:238020
Ig 19216..19293 CDD:416386
Ig strand B 19223..19229 CDD:409353
Ig strand C 19235..19241 CDD:409353
Ig strand D 19251..19256 CDD:409353
Ig strand E 19257..19263 CDD:409353
Ig strand F 19272..19280 CDD:409353
Ig strand G 19283..19293 CDD:409353
FN3 19297..19384 CDD:238020
FN3 19397..19486 CDD:238020
Ig 19507..19587 CDD:416386
Ig strand A 19507..19510 CDD:409353
Ig strand B 19515..19521 CDD:409353
Ig strand C 19527..19533 CDD:409353
Ig strand D 19545..19550 CDD:409353
Ig strand E 19551..19557 CDD:409353
Ig strand F 19566..19574 CDD:409353
Ig strand G 19577..19587 CDD:409353
FN3 19591..19683 CDD:238020
FN3 19691..19782 CDD:238020
FN3 19791..19877 CDD:238020
Ig 19904..19985 CDD:416386
Ig strand A 19904..19908 CDD:409353
Ig strand B 19913..19919 CDD:409353
Ig strand C 19925..19931 CDD:409353
Ig strand D 19943..19948 CDD:409353
Ig strand E 19949..19955 CDD:409353
Ig strand F 19964..19972 CDD:409353
Ig strand G 19975..19985 CDD:409353
FN3 19989..20079 CDD:238020
FN3 20088..20181 CDD:238020
Ig 20188..20281 CDD:416386
Ig strand A 20188..20190 CDD:409353
Ig strand A' 20193..20198 CDD:409353
Ig strand B 20206..20214 CDD:409353
Ig strand C 20219..20223 CDD:409353
Ig strand C' 20227..20229 CDD:409353
Ig strand D 20236..20242 CDD:409353
Ig strand E 20245..20250 CDD:409353
Ig strand F 20259..20267 CDD:409353
Ig strand G 20270..20281 CDD:409353
FN3 20284..20375 CDD:238020
FN3 20383..20476 CDD:238020
FN3 20484..20582 CDD:238020
Ig_Titin_like 20603..20682 CDD:409406
Ig strand B 20611..20615 CDD:409406
Ig strand C 20624..20628 CDD:409406
Ig strand E 20648..20652 CDD:409406
Ig strand F 20662..20667 CDD:409406
Ig strand G 20675..20678 CDD:409406
FN3 20686..20772 CDD:238020
FN3 20786..20869 CDD:238020
Ig 20895..20975 CDD:416386
Ig strand A 20895..20898 CDD:409353
Ig strand B 20903..20909 CDD:409353
Ig strand C 20915..20921 CDD:409353
Ig strand D 20933..20938 CDD:409353
Ig strand E 20939..20945 CDD:409353
Ig strand F 20954..20962 CDD:409353
Ig strand G 20965..20975 CDD:409353
FN3 20979..21067 CDD:238020
FN3 21079..21172 CDD:238020
FN3 21178..21272 CDD:238020
Ig 21292..21372 CDD:416386
Ig strand A 21292..21295 CDD:409353
Ig strand B 21300..21306 CDD:409353
Ig strand C 21312..21318 CDD:409353
Ig strand D 21330..21335 CDD:409353
Ig strand E 21336..21342 CDD:409353
Ig strand F 21351..21359 CDD:409353
Ig strand G 21362..21372 CDD:409353
FN3 21376..21467 CDD:238020
FN3 21475..21567 CDD:238020
FN3 21576..21664 CDD:238020
Ig_Titin_like 21689..21770 CDD:409406
Ig strand B 21698..21702 CDD:409406
Ig strand C 21711..21715 CDD:409406
Ig strand E 21736..21740 CDD:409406
Ig strand F 21750..21755 CDD:409406
Ig strand G 21763..21766 CDD:409406
FN3 21774..21865 CDD:238020
FN3 21871..21955 CDD:238020
Ig_Titin_like 21978..22059 CDD:409406
Ig strand B 21987..21991 CDD:409406
Ig strand C 22000..22004 CDD:409406
Ig strand E 22025..22029 CDD:409406
Ig strand F 22039..22044 CDD:409406
Ig strand G 22052..22055 CDD:409406
FN3 22063..22155 CDD:238020
FN3 22163..22256 CDD:238020
FN3 22262..22351 CDD:238020
Ig 22375..22456 CDD:416386
Ig strand A 22375..22378 CDD:409353
Ig strand B 22383..22390 CDD:409353
Ig strand C 22396..22402 CDD:409353
Ig strand D 22414..22419 CDD:409353
Ig strand E 22420..22426 CDD:409353
Ig strand F 22435..22443 CDD:409353
Ig strand G 22446..22456 CDD:409353
FN3 22460..22551 CDD:238020
FN3 22566..22649 CDD:238020
FN3 22660..22747 CDD:238020
Ig_Titin_like 22772..22851 CDD:409406
Ig strand B 22781..22785 CDD:409406
Ig strand C 22794..22798 CDD:409406
Ig strand E 22817..22821 CDD:409406
Ig strand F 22831..22836 CDD:409406
Ig strand G 22844..22847 CDD:409406
FN3 22855..22944 CDD:238020
FN3 22952..23043 CDD:238020
Ig_Titin_like 23062..23142 CDD:409406
Ig strand B 23070..23074 CDD:409406
Ig strand C 23083..23087 CDD:409406
Ig strand E 23108..23112 CDD:409406
Ig strand F 23122..23127 CDD:409406
Ig strand G 23135..23138 CDD:409406
FN3 23146..23238 CDD:238020
FN3 23246..23336 CDD:238020
FN3 23345..23438 CDD:238020
Ig 23457..23538 CDD:416386
Ig strand A 23457..23461 CDD:409353
Ig strand B 23466..23472 CDD:409353
Ig strand C 23478..23484 CDD:409353
Ig strand D 23496..23501 CDD:409353
Ig strand E 23502..23508 CDD:409353
Ig strand F 23517..23525 CDD:409353
Ig strand G 23528..23538 CDD:409353
FN3 23542..23633 CDD:238020
FN3 23642..23734 CDD:238020
FN3 23743..23830 CDD:238020
Ig_Titin_like 23856..23935 CDD:409406
Ig strand B 23865..23869 CDD:409406
Ig strand C 23878..23882 CDD:409406
Ig strand E 23901..23905 CDD:409406
Ig strand F 23915..23920 CDD:409406
Ig strand G 23928..23931 CDD:409406
FN3 23939..24028 CDD:238020
FN3 24036..24119 CDD:238020
Ig_Titin_like 24143..24224 CDD:409406
Ig strand B 24152..24156 CDD:409406
Ig strand C 24165..24169 CDD:409406
Ig strand E 24190..24194 CDD:409406
Ig strand F 24204..24209 CDD:409406
Ig strand G 24217..24220 CDD:409406
FN3 24228..24320 CDD:238020
FN3 24328..24420 CDD:238020
FN3 24427..24520 CDD:238020
Ig_Titin_like 24539..24620 CDD:409406
Ig strand B 24548..24552 CDD:409406
Ig strand C 24561..24565 CDD:409406
Ig strand E 24586..24590 CDD:409406
Ig strand F 24600..24605 CDD:409406
Ig strand G 24613..24616 CDD:409406
FN3 24624..24716 CDD:238020
FN3 24724..24813 CDD:238020
FN3 24825..24913 CDD:238020
Ig_Titin_like 24938..25017 CDD:409406
Ig strand B 24947..24951 CDD:409406
Ig strand C 24960..24964 CDD:409406
Ig strand E 24983..24987 CDD:409406
Ig strand F 24997..25002 CDD:409406
Ig strand G 25010..25013 CDD:409406
FN3 25021..25108 CDD:238020
FN3 25118..25201 CDD:238020
Ig 25226..25305 CDD:416386
Ig strand A 25226..25229 CDD:409353
Ig strand B 25234..25240 CDD:409353
Ig strand C 25246..25252 CDD:409353
Ig strand D 25264..25269 CDD:409353
Ig strand E 25270..25276 CDD:409353
Ig strand F 25285..25293 CDD:409353
Ig strand G 25296..25305 CDD:409353
FN3 25310..25402 CDD:238020
FN3 25410..25503 CDD:238020
FN3 25509..25602 CDD:238020
Ig 25621..25702 CDD:416386
Ig strand A 25621..25625 CDD:409353
Ig strand B 25630..25636 CDD:409353
Ig strand C 25642..25648 CDD:409353
Ig strand D 25660..25665 CDD:409353
Ig strand E 25666..25672 CDD:409353
Ig strand F 25681..25689 CDD:409353
Ig strand G 25692..25702 CDD:409353
FN3 25706..25797 CDD:238020
FN3 25806..25896 CDD:238020
FN3 25907..25995 CDD:238020
Ig_Titin_like 26021..26099 CDD:409406
Ig strand B 26029..26033 CDD:409406
Ig strand C 26042..26046 CDD:409406
Ig strand E 26065..26069 CDD:409406
Ig strand F 26079..26084 CDD:409406
Ig strand G 26092..26095 CDD:409406
FN3 26103..26194 CDD:238020
FN3 26200..26283 CDD:238020
Ig_Titin_like 26307..26388 CDD:409406
Ig strand B 26316..26320 CDD:409406
Ig strand C 26329..26333 CDD:409406
Ig strand E 26354..26358 CDD:409406
Ig strand F 26368..26373 CDD:409406
Ig strand G 26381..26384 CDD:409406
FN3 26392..26485 CDD:238020
FN3 26492..26585 CDD:238020
FN3 26591..26684 CDD:238020
Ig 26703..26785 CDD:416386
Ig strand A 26703..26707 CDD:409353
Ig strand B 26712..26718 CDD:409353
Ig strand C 26724..26730 CDD:409353
Ig strand D 26743..26748 CDD:409353
Ig strand E 26749..26755 CDD:409353
Ig strand F 26764..26772 CDD:409353
Ig strand G 26775..26785 CDD:409353
FN3 26789..26881 CDD:238020
FN3 26889..26981 CDD:238020
FN3 26990..27078 CDD:238020
Ig_Titin_like 27103..27182 CDD:409406
Ig strand B 27112..27116 CDD:409406
Ig strand C 27125..27129 CDD:409406
Ig strand E 27148..27152 CDD:409406
Ig strand F 27162..27167 CDD:409406
Ig strand G 27175..27178 CDD:409406
FN3 27186..27275 CDD:238020
FN3 27283..27366 CDD:238020
Ig_Titin_like 27390..27471 CDD:409406
Ig strand B 27399..27403 CDD:409406
Ig strand C 27412..27416 CDD:409406
Ig strand E 27437..27441 CDD:409406
Ig strand F 27451..27456 CDD:409406
Ig strand G 27464..27467 CDD:409406
FN3 27475..27566 CDD:238020
FN3 27574..27658 CDD:238020
FN3 27673..27766 CDD:238020
Ig_Titin_like 27785..27866 CDD:409406
Ig strand B 27794..27798 CDD:409406
Ig strand C 27807..27811 CDD:409406
Ig strand E 27832..27836 CDD:409406
Ig strand F 27846..27851 CDD:409406
Ig strand G 27859..27862 CDD:409406
FN3 27870..27962 CDD:238020
FN3 27970..28060 CDD:238020
FN3 28071..28163 CDD:238020
Ig_Titin_like 28182..28261 CDD:409406
Ig strand B 28191..28195 CDD:409406
Ig strand C 28204..28208 CDD:409406
Ig strand E 28227..28231 CDD:409406
Ig strand F 28241..28246 CDD:409406
Ig strand G 28254..28257 CDD:409406
FN3 28265..28356 CDD:238020
FN3 28362..28445 CDD:238020
Ig_Titin_like 28472..28553 CDD:409406
Ig strand B 28481..28485 CDD:409406
Ig strand C 28494..28498 CDD:409406
Ig strand E 28519..28523 CDD:409406
Ig strand F 28533..28538 CDD:409406
Ig strand G 28546..28549 CDD:409406
FN3 28557..28650 CDD:238020
FN3 28657..28747 CDD:238020
FN3 28756..28849 CDD:238020
Ig_Titin_like 28868..28949 CDD:409406
Ig strand B 28877..28881 CDD:409406
Ig strand C 28890..28894 CDD:409406
Ig strand E 28915..28919 CDD:409406
Ig strand F 28929..28934 CDD:409406
Ig strand G 28942..28945 CDD:409406
FN3 28953..29045 CDD:238020
FN3 29053..29145 CDD:238020
FN3 29154..29245 CDD:238020
Ig_Titin_like 29268..29349 CDD:409406
Ig strand B 29276..29280 CDD:409406
Ig strand C 29289..29293 CDD:409406
Ig strand E 29314..29318 CDD:409406
Ig strand F 29328..29333 CDD:409406
Ig strand G 29342..29345 CDD:409406
FN3 29353..29442 CDD:238020
FN3 29450..29541 CDD:238020
Ig 29560..29627 CDD:416386
Ig strand A 29560..29563 CDD:409353
Ig strand B 29568..29574 CDD:409353
Ig strand C 29580..29586 CDD:409353
Ig strand D 29598..29603 CDD:409353
Ig strand E 29604..29610 CDD:409353
Ig strand F 29619..29627 CDD:409353
FN3 29644..29736 CDD:238020
FN3 29744..29836 CDD:238020
FN3 29843..29931 CDD:238020
Ig 29955..30035 CDD:416386
Ig strand A 29955..29958 CDD:409353
Ig strand B 29963..29969 CDD:409353
Ig strand C 29975..29981 CDD:409353
Ig strand D 29991..29996 CDD:409353
Ig strand E 29997..30005 CDD:409353
Ig strand F 30014..30022 CDD:409353
Ig strand G 30025..30035 CDD:409353
FN3 30046..30131 CDD:238020
FN3 30139..30226 CDD:238020
FN3 30241..30330 CDD:238020
Ig_Titin_like 30353..30432 CDD:409406
Ig strand B 30362..30366 CDD:409406
Ig strand C 30375..30379 CDD:409406
Ig strand E 30398..30402 CDD:409406
Ig strand F 30412..30417 CDD:409406
Ig strand G 30425..30428 CDD:409406
FN3 30436..30520 CDD:238020
FN3 30533..30616 CDD:238020
Ig_Titin_like 30644..30724 CDD:409406
Ig strand B 30652..30656 CDD:409406
Ig strand C 30665..30669 CDD:409406
Ig strand E 30690..30694 CDD:409406
Ig strand F 30704..30709 CDD:409406
Ig strand G 30717..30720 CDD:409406
FN3 30728..30820 CDD:238020
FN3 30828..30920 CDD:238020
FN3 30927..31023 CDD:238020
Ig 31044..31124 CDD:416386
Ig strand A 31044..31047 CDD:409353
Ig strand B 31052..31058 CDD:409353
Ig strand C 31064..31070 CDD:409353
Ig strand D 31082..31087 CDD:409353
Ig strand E 31088..31094 CDD:409353
Ig strand G 32204..32207 CDD:409406
FN3 32215..32305 CDD:238020
FN3 32325..32410 CDD:238020
FN3 32418..32503 CDD:238020
I-set 32528..32607 CDD:400151
Ig strand B 32537..32541 CDD:409353
Ig strand C 32550..32554 CDD:409353
Ig strand E 32575..32579 CDD:409353
Ig strand F 32589..32594 CDD:409353
Ig 32629..32704 CDD:416386
Ig strand B 32633..32639 CDD:409353
Ig strand C 32645..32651 CDD:409353
Ig strand D 32663..32668 CDD:409353
Ig strand E 32669..32675 CDD:409353
Ig strand F 32685..32693 CDD:409353
Ig strand G 32696..32704 CDD:409353
FN3 32710..32803 CDD:238020
FN3 32812..32905 CDD:238020
Ig 32915..33007 CDD:416386
Ig strand A 32915..32917 CDD:409353
Ig strand A' 32919..32925 CDD:409353
Ig strand B 32932..32939 CDD:409353
Ig strand C 32945..32950 CDD:409353
Ig strand C' 32952..32955 CDD:409353
Ig strand D 32961..32965 CDD:409353
Ig strand E 32971..32978 CDD:409353
Ig strand F 32985..32993 CDD:409353
Ig strand G 32996..33007 CDD:409353
Ig_Titin_like 33024..33105 CDD:409406
Ig strand B 33032..33036 CDD:409406
Ig strand C 33045..33049 CDD:409406
Ig strand E 33070..33074 CDD:409406
Ig strand F 33085..33090 CDD:409406
Ig strand G 33098..33101 CDD:409406
FN3 33109..33200 CDD:238020
STKc_Titin 33237..33513 CDD:271006
IgI_Titin_M1-like 33556..33645 CDD:409521
Ig strand B 33572..33576 CDD:409521
Ig strand C 33586..33590 CDD:409521
Ig strand E 33611..33615 CDD:409521
Ig strand F 33625..33630 CDD:409521
Ig strand G 33638..33641 CDD:409521
I-set 33676..33768 CDD:400151
Ig strand A 33676..33678 CDD:409353
Ig strand A' 33680..33686 CDD:409353
Ig strand B 33693..33700 CDD:409353
Ig strand C 33706..33711 CDD:409353
Ig strand C' 33713..33716 CDD:409353
Ig strand D 33724..33728 CDD:409353
Ig strand E 33733..33740 CDD:409353
Ig strand F 33747..33755 CDD:409353
Ig strand G 33758..33768 CDD:409353
I-set 33781..33871 CDD:400151
Ig strand A' 33786..33790 CDD:409353
Ig strand B 33798..33806 CDD:409353
Ig strand C 33811..33816 CDD:409353
Ig strand C' 33819..33821 CDD:409353
Ig strand D 33827..33832 CDD:409353
Ig strand E 33836..33841 CDD:409353
Ig strand F 33850..33858 CDD:409353
Ig strand G 33861..33871 CDD:409353
Ig 34361..34450 CDD:416386
Ig strand A 34361..34363 CDD:409353
Ig strand A' 34365..34371 CDD:409353
Ig strand B 34378..34385 CDD:409353
Ig strand C 34391..34396 CDD:409353
Ig strand C' 34398..34401 CDD:409353
Ig strand D 34406..34410 CDD:409353
Ig strand E 34415..34422 CDD:409353
Ig strand F 34429..34437 CDD:409353
Ig strand G 34440..34450 CDD:409353
PTZ00121 <34455..35189 CDD:173412
IgI_Titin_like 34545..34636 CDD:143224
Ig strand B 34565..34569 CDD:143224
Ig strand C 34578..34582 CDD:143224
Ig strand E 34603..34607 CDD:143224
Ig strand F 34617..34622 CDD:143224
Ig strand G 34630..34633 CDD:143224
Ig 34705..34794 CDD:416386
Ig strand B 34720..34724 CDD:409353
Ig strand C 34735..34739 CDD:409353
Ig strand E 34761..34765 CDD:409353
Ig strand F 34775..34780 CDD:409353
Ig strand A 34884..34891 CDD:409353
I-set 34891..34980 CDD:400151
Ig strand A' 34898..34903 CDD:409353
Ig strand B 34908..34916 CDD:409353
Ig strand C 34920..34926 CDD:409353
Ig strand C' 34928..34930 CDD:409353
Ig strand D 34936..34942 CDD:409353
Ig strand E 34945..34951 CDD:409353
Ig strand F 34960..34967 CDD:409353
Ig strand G 34970..34979 CDD:409353
I-set 35173..35262 CDD:400151
Ig strand A 35173..35175 CDD:409353
Ig strand A' 35177..35183 CDD:409353
Ig strand B 35190..35197 CDD:409353
Ig strand C 35203..35208 CDD:409353
Ig strand C' 35210..35213 CDD:409353
Ig strand E 35227..35234 CDD:409353
Ig strand F 35241..35249 CDD:409353
Ig strand G 35252..35262 CDD:409353
I-set 35368..35460 CDD:400151
Ig strand A 35377..35380 CDD:409353
Ig strand B 35385..35391 CDD:409353
Ig strand C 35397..35403 CDD:409353
Ig strand D 35418..35423 CDD:409353
Ig strand E 35424..35430 CDD:409353
Ig strand F 35439..35447 CDD:409353
Ig strand G 35450..35458 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9818
eggNOG 1 0.900 - - E1_KOG4475
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100287
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.