DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obsc and ketn-1

DIOPT Version :10

Sequence 1:NP_001097440.1 Gene:Obsc / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:NP_001294668.1 Gene:ketn-1 / 178740 WormBaseID:WBGene00004130 Length:4963 Species:Caenorhabditis elegans


Alignment Length:4741 Identity:924/4741 - (19%)
Similarity:1531/4741 - (32%) Gaps:1636/4741 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 SVPSRAYDN-RFLSSIEGC----------------RGNIYKL-------GRLLLHAWCNVVDKEG 296
            ||.::|::. .|.:.:.|.                .|..||:       |||::..    ||   
 Worm   714 SVAAKAFETVTFSAKVVGTPTPSLTWQKSDGTVIQSGGKYKIENGPDGSGRLIIEK----VD--- 771

  Fly   297 KAHDRYCFL---------FKSRILVTKVRKISENRSVFILQNIVKLPLCNIELKADEKQIHLSLK 352
             |||...::         |:||.            |:.:||                      .|
 Worm   772 -AHDADMYMLVARNDGGSFQSRF------------SLNVLQ----------------------AK 801

  Fly   353 APEANSF--------------LPIDIKPHGPEAHLTWF------------------NEISSHINQ 385
            :|||..|              :.:..|..|......||                  ||.:.||| 
 Worm   802 SPEAPEFTGKFQSTTLYDGDSVKLYCKAAGEGVSFKWFKDNEPISSGGSYAVDNKGNETTLHIN- 865

  Fly   386 DVTLQE-----------HNADDLKVDASQIASESELILHLPQR--AEAHDPNLSVRPSDVAENYF 437
            :.|::|           |....||         ..::::..|:  ..||...:::|..|      
 Worm   866 NATMKEGGWYRCDATNKHGTTTLK---------GRVVVNSRQKFNGPAHREMITLRKVD------ 915

  Fly   438 LSKETKERLQHEQQELLKLEQEAIELYKKQQSSKSVSSKTESVEITSSQVKSSSEVRKVV--SPP 500
                             |:|:....:.:.|..|.|.||......:.|.|:......|..:  :|.
 Worm   916 -----------------KVERSRTPVNQLQDVSASKSSPKFEGSLQSQQLVEGQSARLEIKYTPV 963

  Fly   501 PPPQAQVKEVTPVKVVSSPPPPKEITPAKVATPPPQPQVVTSPVKEVAPPPQPRAVASPAKEVTP 565
            ..|..::..:...|.:.:                 ..::||.....:|           |.|:.|
 Worm   964 EDPNLRIAWLLNGKGILA-----------------SSRIVTFTDFGIA-----------ALEINP 1000

  Fly   566 ----SQSE-PVKAPSPIKEVRKEVPPSASHSKEVEALVAT-------EIRESLTETRSTVVESGQ 618
                .|.| .|.|.:|:.|.|            |.|.:|.       :.::|.::...|..:|..
 Worm  1001 VNVFDQGEYTVVAVNPLGEAR------------VSANIAVIGHGSFIQQQQSGSQFGGTAYQSKG 1053

  Fly   619 S--------------SEIREEIVVTEESSLEGKQVVALEREPSPCSIPKIQVYRPVECENPVVTK 669
            :              |::|.:.|      .||:| :.||.:.:|.:.|.::|.            
 Worm  1054 AQAPAGTHLDLPNFHSDLRSQEV------FEGQQ-IHLETKLTPINDPDLRVV------------ 1099

  Fly   670 HKPIELKDIVGYSESLRDGDTAPAGGSPGRQQGYSANIT-DHASLTI----------WNNRLANI 723
                          .|.||:..|:...      |...:: ..|||.|          ::.|..|.
 Worm  1100 --------------WLLDGNELPSNDK------YRQTLSHGFASLDIPQTSSNDSGLYSCRAFNK 1144

  Fly   724 AG--------------DRSGANQHLQ---------QSGPPPPPIPPNF-TRMPGFF--QPLPLIA 762
            .|              |.....||.|         |.......:.|.| :::..|.  |.|....
 Worm  1145 LGESENQATIIIVPKSDLQQFEQHRQLDVEDVREIQFAHSSQDLTPKFLSQIQPFHCEQELGRSF 1209

  Fly   763 YETTIEILIVKARPPSPPP---------PPPPTIKRVLVHTESLEQKTQNFFEGIYDAASSDTSL 818
            :|..|:       |.:.|.         .|.|...|:        |..|||  |:...:...|..
 Worm  1210 FEARIQ-------PINDPTLRVSWLKDGQPLPNANRI--------QIFQNF--GVVSLSLHPTYP 1257

  Fly   819 RNAKQKIRSIKSTVL--------KSKDSTNYAQDTVQ-KAKARDFL-----------HIFTPPVK 863
            .:|     .:.:.||        .|.:.|....||:| .:|..|.|           ||....|:
 Worm  1258 EDA-----GVYTCVLFNSHGQAQSSAELTTVWIDTLQLDSKHADSLPIIGYLDSHQIHIGPQSVE 1317

  Fly   864 KRPIYEIVEEPVNIFELEGDYTESIADDFREPSADFEARGQSVGG----MDDYYSGYSRASTRRY 924
            :...:..:|.|....||.|..  .:.::.|   ..||||......    ::.|::|....:..|:
 Worm  1318 RPEEFNSLEAPKFARELAGKI--EVMENER---VHFEARILPANDVKMTVEWYHNGNPLPAAHRF 1377

  Fly   925 ETKTRDYDRG-----TSYDSTVERSQYGISSRRDRSSVDKVEARSSLLATGRTESRAASRAESRA 984
            ...   :|.|     ..|....:...|.:.:|.:..     ||||::.....||           
 Worm  1378 HPM---FDFGYVALDLLYAYPQDSGTYTLVARNELG-----EARSNVELVVGTE----------- 1423

  Fly   985 ESRASYSVAESRAGIRSSSRLQEDRPL-------RSVD-KPVVVKMLKSVQVEPGETAHFEIQ-- 1039
              :..|.......|:.....|::||..       |:.| .|..:..|..:|:...|..|.:::  
 Worm  1424 --KVLYLEPHHPEGLERIKELEQDRRQGIAEVEDRTCDAAPKFLNDLPDIQLNEHENIHVDLRAT 1486

  Fly  1040 -FKDQPGLVTWLKDNKPLEDRLADRITQTAAPMNSYRLDIKNCSETDAGTYTIRA--------QS 1095
             ..|...::.|..:.:||   |.....:|........||||.....|:|||::||        :.
 Worm  1487 PVNDPTMVIEWFVNGRPL---LTGSRVKTLNEFGFIALDIKGAIAEDSGTYSVRASNLLGEAIRQ 1548

  Fly  1096 ASETTTVSAQLAVGQAPGHDET--KTN-------------------TEPAFLVSLK----DAEMI 1135
            ...|.|.:.|:.  ....|.|:  |.|                   ..|.|:|.|:    |.|..
 Worm  1549 CVITVTPAGQIL--SDTQHQESLGKINYLENLNKYGRVEIEDKGPQEPPTFVVPLQADLGDVEEG 1611

  Fly  1136 ENTLFRFMVKIIGDPKPRVKFYKDEKEILETNDRIQIIRDKDYLGFYELVIADVQKTDAGTYSCK 1200
            |.......|..|.|...::.:.:|.:. |....|.:...|   .||..|.|......|||||:|:
 Worm  1612 EPIHLECQVNPINDNSLKIIWLRDGQS-LPHGHRFRTFYD---FGFVSLDILGFYAQDAGTYTCR 1672

  Fly  1201 ATNKHGEANCEAIAT-------------------------------------------------- 1215
            |.|..|:|  |.:||                                                  
 Worm  1673 AENSLGQA--ETVATIRCAPKDAILGAVQHPRSYARIQEIEAPKPAPQEVPDLPHQPPAFVKQLG 1735

  Fly  1216 ----TVEDKNPFGALSGQILPAGEKPV-FQWKRNGEEFDPEERFKVLFGEDEDSLALVFQHVKPE 1275
                .:|..|.:  |..|:.|..:..: ::|..||:......||  :..:|...:||...:..||
 Worm  1736 PAIQCMEGDNVY--LEAQVTPTDDNSLTYEWLVNGQPLMKAHRF--VLSQDFGYIALNILYCYPE 1796

  Fly  1276 DAGIYTCVAQT------STGNISCS------------------AELS--VQGAIQTLNREPEKPT 1314
            |.|.||.|.:.      ||.:|:|.                  |||.  :|.|....::|.|.||
 Worm  1797 DNGTYTLVVRNRAGEAQSTVDINCGHTGGNFTDSFHPNSLHRIAELETPIQRAEPLPDKEKEVPT 1861

  Fly  1315 LVIEHREANASIGGSAILELQCKGFP----KPAVQWKHDGEVIQVDDRHKFMYEDEESMSLVIKN 1375
            :.........|:..|..|.|:.:..|    ....:|..:|..::...|::.: .|...:||.|..
 Worm  1862 IAKPLPATIDSVHESQTLHLEAQVTPIDDNTLRYEWLFNGNPLKASSRYRVL-NDFGFVSLDIDY 1925

  Fly  1376 VDTVDAGVYTIEAINELGQDESSINLVVKA----------PPKIKKITDI--------------- 1415
            :...|:|.||:...|..|:.|:|....|..          |..:::|.::               
 Worm  1926 IIAEDSGKYTLVVYNSAGRAETSCEFQVDRLKSILSDTAHPESLRRIREMEQLQPAKPSDDDAAA 1990

  Fly  1416 --------------TCSAGETIKMEIEVEGFPQPTVQVT--NNGKDVTAESNVKISSSSIGKSLE 1464
                          ....|:::.|:..|:....|::::.  ::|:.:...|.:: :....|    
 Worm  1991 QPPVFTQQLTGPTEPLKEGQSVHMDCVVQPINDPSLRIEWFHDGRPLMFGSRIR-TIHDFG---- 2050

  Fly  1465 KVVVEVKEIKLSQAGNYSIKATNDLSQ--TSEYWSCTVKSKPVIVKNFESEYIH----------- 1516
            .|.:|...|.....|.|:.||||.:.:  |..:..|..:....:..:.||.:..           
 Worm  2051 YVGLEFLHIHPEDTGTYTCKATNLIGEATTDIFLECKPRRNIYLDTHHESSWQKIQEIENRVDER 2115

  Fly  1517 -----------------GEKENVQ--MTVRIDAY------PEAKLTWYHDETEIKITDSKYTVSS 1556
                             .:||:.|  .::|::..      |..::||..:...:. ..|::..:.
 Worm  2116 EPTPELTFQPPTFTENLADKEDAQEGQSIRLECRLIPVNDPTMRVTWTRNGQPLP-EASRFMPAR 2179

  Fly  1557 DGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQLLIKCAP------EFTHKLKNITVAEGDS 1615
            :.:...|.|......|:|.||.||.:..|.|  :|...:|||.      :..|......|.|.: 
 Worm  2180 NFDYVNLDILALYGEDSGVYTCKAVSAFGEA--ATSCTVKCAAGKSLLLDTMHDASWKRVQEIE- 2241

  Fly  1616 NVELVVGVDAYPRPHAKWYI-----------DGIEIDEKRNDFRHVEEGNDFKLIM--------- 1660
            |.|.:..|||.|...|..::           :|:.|..:    ..||..||.:|.:         
 Worm  2242 NREKLEAVDAEPEKTAPKFVTQLNSSLGELQEGVPIHLE----AQVEPTNDNQLTVQWFHNGQPL 2302

  Fly  1661 ------------NQVATNM-------QGNYTCKIMNDYGKLEDNCVVTV---------------- 1690
                        ..||.::       .|.:.|...|..|:.:.....||                
 Worm  2303 ANGHRFRTRHDFGYVALDILYAFAQDTGEWACVARNSLGEAQTIANFTVLPRGTIYTDSQHPESW 2367

  Fly  1691 --------------------NCKPKVKRGLKNVEVQEGKS--FTLEVEVYSEPEAKIKWFKDGHE 1733
                                :..|:....|.:::..|.:|  |..:|...::|..:|:|||||..
 Worm  2368 QKIQVLEAPRAAAPEKPDAEHDAPQFIEPLDSIDRMEFQSAHFQTKVTPQTDPNLRIQWFKDGQP 2432

  Fly  1734 IYEDARIKISRDTQRIENYYLTLNLART--EDAGTYEMKATNFIGETTSTCKVAVLTSEALSL-- 1794
            :....|.|::.|..     |::|::|.|  ||:|.|.:||:|..|:.....::.| |..|:.|  
 Worm  2433 LMNSNRFKLTTDFG-----YISLDIAHTVPEDSGVYSVKASNAKGDAEVQAQLTV-TGNAVILGD 2491

  Fly  1795 ---EQTVTK-TLIATTEEPEEGAVPEIVHVD---VFQQHSYESV----PLKYEV--IATGIPKPE 1846
               ||:..| .||.....|.| ..|::.|..   |.|.||.:.|    |..:|.  |....||..
 Worm  2492 TQHEQSWQKIQLIEAPRAPGE-EEPDVKHGPPKFVTQLHSLDGVVEGQPSHFEAQFIPFSDPKTS 2555

  Fly  1847 AIWYHDGKPITPDKHTAITVDGDHYKLEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSLS----- 1906
            ..||.:|.|::......:..|.....|::|.....|||||.|||:|..||....|:||.:     
 Worm  2556 VQWYLNGNPLSASSRRILRNDFGLVSLDLQYTLGEDAGEYSVVVKNSEGEDRTSGQLSCTTRAAI 2620

  Fly  1907 -----------GIAEYRKPILTQGPGLK-DIKVNKGDKVCEPVVFTAD-PAPEIVLLK------- 1951
                       .|.|...|   :.||.: :..|.:.....:|:....| |...:.||:       
 Worm  2621 LGDTQHEQSWQRIQEIEAP---RAPGAEPEGPVYEKPSFVQPLQSVGDLPEGSVALLEARLVPVN 2682

  Fly  1952 ----------DGQPVVETNNVKLKVDKKDAENGLVQYTC-TLNILEAEIKDSGRYELKVKNKYGE 2005
                      :.||::|:|.:....|          :.| :|.|.....:.:|.|..|..|..|.
 Worm  2683 DPNLRVQWFYNDQPLMESNWISTSND----------FGCVSLRIAPVYARHTGVYSCKAWNDSGN 2737

  Fly  2006 LVTSGWIDVLAKPEISGLNDTKCLPGDTICFEALVQANPKPKVSWTRGNENL---CNH-ENCEVI 2066
            .|||..:.|                                     :|:|.|   .:| .:.:.|
 Worm  2738 AVTSANVGV-------------------------------------QGSEGLLLDTSHPASLQKI 2765

  Fly  2067 ADVDA-DKYRLVFQSVSPCEDGKYTITATNSEGRAAVDFNLAVLVEKPTFIVQPESQSIHDYRPV 2130
            .:::| |||.              .:.|...|            .|||.::     |...:|..|
 Worm  2766 QELEAIDKYA--------------RLDAPERE------------YEKPQWV-----QGFENYENV 2799

  Fly  2131 --STKVLVHGVPLPT------IEWFKDDKPI--------NYEAINKPGKDKLYAKEDTKKGTDQI 2179
              ...|.:||:..|:      :||..:..|:        .||..|                    
 Worm  2800 GEGQTVTLHGLVEPSGDPHLRLEWLLNGTPLRNANRFRQEYEFGN-------------------- 2844

  Fly  2180 ESVLDIKSFRENDVGAYTCVATNEIG-------VTKAPFKLAMLSL------------------- 2218
             ::|.|.....:|.|.|||.|.|..|       ||.|.::..:...                   
 Worm  2845 -AILTIVHVLPHDSGVYTCRAWNTQGEASTSATVTTAGYEKILYDSQHPVSWERIQELEAPKIVE 2908

  Fly  2219 ---------APSFVKKLDNALDVLQGEPLVLECCVDGS--PLPTVQWLKDGDEVKPSESIKISTN 2272
                     .|:|:.:|::|.:|.:|.||.||.....:  |...|.|.|:|..:..|:.:: :.:
 Worm  2909 EIEEIVQKEKPNFLTQLESAENVPEGVPLHLESTFQPARDPELKVVWQKNGQPLGASQLVQ-TKH 2972

  Fly  2273 PDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAV-----------------------KPE 2314
            ..|...|:|:|...:.:|.|.|.|:|..||.|:..::.|                       .|:
 Worm  2973 ELGWATLDISSANEDHNGVYTLTITNSEGEAVSTASIRVAGTGPILGNTRHEESWKRIQILEAPK 3037

  Fly  2315 EMQPKFLKPITSQTVVV----------GEPLKLEAQVT--GFPAPEVKWYKDGMLLRPSPEINFI 2367
            |.:|:...|:.....:.          |:.:..||.:|  ..|..:|:|.::|:.|....:. .|
 Worm  3038 EAEPEAPAPVYDHPAITTQIDDKECNEGDHVHFEALITPVNDPRLQVQWIRNGVPLAHGSKY-AI 3101

  Fly  2368 NSPNGQIGLIIDAAQPLDAGVYKCLIANKGGEI------------------------EGVSKVEI 2408
            ....|...|.:....|.|.|||:..|.|..||.                        :.:.::| 
 Worm  3102 QQDFGICTLDVAYTYPEDEGVYQLRIWNPEGEAVSSATLKCHGKDAILGDVQHQESWKRIQEIE- 3165

  Fly  2409 VPKE----------SKPVFVAELQDASS-IEGFPVKMD--IKVVGNPKPKLQWFHNGHEIKPDAS 2460
            .||:          ..|.|:.:|....| :|..|...:  ::.|.:|...:.||.||..:.. :|
 Worm  3166 APKQKLEEADPEPKGPPRFIQQLTSPGSLVENQPAHFEATVEPVDDPTLTINWFLNGEPMSA-SS 3229

  Fly  2461 HIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPK---------------- 2509
            .:.:: |......:.|.:|.|.|||.::.:|:|..|...|.|.:.|..|                
 Worm  3230 RVKMI-NDFGWVIMDIAQTEPRDSGEWKCVAKNAAGEAVSTATIEVQGKEVILQDSLQPQSLDRI 3293

  Fly  2510 ----ADETATE-------EAPQFVSALRDVNA-DEGQELVLSAPF--ISNPMPEVIWSKDGVTLT 2560
                |.:.|.|       |||..|:||:...| :||....|...|  :::|..:|.|.|||..:.
 Worm  3294 RQIEAGKPAPEERPDQQFEAPAIVNALQVQGALEEGGSAHLQTQFTPVADPSIKVEWLKDGQPIF 3358

  Fly  2561 PNERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSSACN-------------------- 2605
            .:.|..|..|.....|.|......|:|.||..::|..||.|::.:                    
 Worm  3359 HSNRYKMVHDFGFAVLDILHLLKHDAGEYTFRVSNNSGEASTSTSFEVSESSGLILQPQNEQKAK 3423

  Fly  2606 ------ANVRKVYKPPVFTQKISDQQQVFGNNAKIPV----------TVSGVPYPD----LEWYF 2650
                  .|:|:  :|....|::.:...||......||          |....|..|    ::||.
 Worm  3424 AVEILEDNLRR--RPEEIEQELKEATPVFIEPLSAPVETEEGGRAHFTARYEPVNDNQLQVQWYH 3486

  Fly  2651 QDKPIPKSEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRL------DIVN--- 2706
            ..:|:....:....|...:.:|.::.....|.|.|.|.|.||.|:.:|..:|      .|::   
 Worm  3487 DGRPLKNGSRIKTINSFGYVVLEISPTYPEDNGEYICRAVNRVGEAVTSTKLTCTPKEGIISATQ 3551

  Fly  2707 ---------------EIKKHSRSE-------PPVFLKKI-GDCDIYEGMVAKFTACATGYPEPE- 2747
                           |..:.:|.:       ||.|...: |..::.||..|......|...:|. 
 Worm  3552 LPERMANAGRRIAEIEAPRPAREDAPDADHGPPKFTSALAGPPELQEGQQAHLECQVTPVADPRL 3616

  Fly  2748 -VEWFKNDQKLFPSDRFLIDIEPNGLLRLTIKNVTEYDVGRYSCRIFNPYGDDICHAEL------ 2805
             :|||.|.|.:..::| :..|...|.:.|.:......|.|.::||..|.:|.|....||      
 Worm  3617 VIEWFHNGQPVNHTNR-MKAIHDFGFVVLQLTPAEPQDSGTWTCRATNQHGSDEVSTELKVVGGG 3680

  Fly  2806 ---------------FYDSLDSQQKPLEDQYTDFKKYKKSGAPPPLSEGPIISRMTDRG------ 2849
                           ..:..|...:|.||.......|    ..|..|:|     :||.|      
 Worm  3681 GVSYEWQSTAERKERITELEDWIHRPKEDLNLPAVDY----PAPSFSQG-----LTDLGQLNEAD 3736

  Fly  2850 ---------------LLLSWNPS---VPLTPRYPITYQIEMMDL--------PEGDWRTLRTGVR 2888
                           |.:.|..:   :|.:.|...|.:..:..|        ..|:::.:.|.|:
 Worm  3737 ATAFVCVLEPIGDPTLRVQWEHNGHPIPYSNRISCTNEFGVATLLIKHLIAADAGEYKCVATNVK 3801

  Fly  2889 SCACDIRNL------------------------------------EPFRDYRFRVR-VENKFGVS 2916
            ..|..:..:                                    .|..|.|..|. :.|...:.
 Worm  3802 GSATSVGKIAVESSTQIDAPQVVQQLVDSVENILEGDSIHLECRVTPINDPRLHVEWLRNGAPLP 3866

  Fly  2917 DPSPYTQTYRQKLV--------PDPPKTY-----------------TYLP-PGTDFRPETSPYFP 2955
            :.|.:..|:....|        |:....|                 |.|| |..|:..:|.....
 Worm  3867 EASRFKPTFEFGFVSLDILYAYPEDNGDYELVVRNDKGEARSKTKITVLPRPSLDYTSQTHGNQQ 3931

  Fly  2956 KDFDIERPPH--------------DGLAQAPQFLLREQDISYGVKDH---NTELMWFVYGYPKPK 3003
            ...:.....|              :...:||:|..:.|:|  ||.:.   ..|........|..|
 Worm  3932 DSLESHFKQHSQAKLQLTANDIYNESDKRAPEFRTQLQNI--GVLEGEFCRFETQVAPINDPYLK 3994

  Fly  3004 MTYYFDDMLIESGGRFDQSYTRNGQATLFINKMLDRDVGWYEAVATNEHGEARQRVRL--EIAEH 3066
            :.::.|...:..|.|| :|....|.|.|.:...|..|.|.|..||||.||:.....:|  :.|.|
 Worm  3995 VEWFKDKKPVLLGHRF-RSTLDFGFACLDLLYALPDDTGEYHCVATNRHGQTMISAKLACQGASH 4058

  Fly  3067 -------PRFL-----KRPDETFIMARKNG---------------------------RIEAKLVG 3092
                   |:.|     |:.::....:.:.|                           |.|..:.|
 Worm  4059 VITDSQMPQGLRVSNVKKDNKNIYWSEQGGAVQPKQKQAPQFTIPLRNLQVTENQPARFECAVTG 4123

  Fly  3093 IPLPEVHWFKDWKPIVDSSRIKISSYDPDIYVLSIHDSIIKDGGLYSISARNIAGSISTSVTVHI 3157
            .|.|:|.||.:....:...|.|: ::| .::.|::..|.|.|.|.....|||..|...::.|:.|
 Worm  4124 YPRPKVTWFINGNQCLHGHRFKL-NFD-GLHYLTVSKSRISDAGEVVAIARNTEGETISTATLDI 4186

  Fly  3158 EENED-------QYIYKTYGRHPYVRSKQLRYQDKYDIGDELGRGTQGITYHAVERSSGDNYAAK 3215
            .:|:|       ...:||...   :|.::|::|     .|.|  |:.|..:.|..:..    |.|
 Worm  4187 FQNDDFRQTKLRPANFKTSDE---LRERELQWQ-----RDTL--GSLGPAFEAAPKPD----AQK 4237

  Fly  3216 IMY---GRPELRPFMLNELEMMNTFNHKNLIRPYDAYDTDRSVTLIMELAAGGELVRDNLLRRDY 3277
            :|:   .:..:.|  :...|::..|.     ||.|                      ||...:..
 Worm  4238 LMHVERAQSPIEP--MESQELIQKFT-----RPRD----------------------DNFYNKLS 4273

  Fly  3278 YTERDIAHYIRQTLWGLEHMHEMGVGHMGLTIKDLLISVVGGDIIKVSDFGLSRKINRHNLSTLD 3342
            |.|.....:                  .|:.::::                           .|.
 Worm  4274 YVELQKPQF------------------KGMELEEV---------------------------NLK 4293

  Fly  3343 YGMPEFVSPEVVNKEGVNF----SHDMWTVGLITYVLLGGHNP-FLGIDDRETLTKIREGRWDFK 3402
            .|..|...|.|...|.||.    ..|...|        |...| :.|.|....|....|||  ||
 Worm  4294 AGKVEKYQPPVEEMERVNLKAIPEKDQQEV--------GWERPDWAGQDGTSKLPGADEGR--FK 4348

  Fly  3403 D----------------EIWTHISDDGRDFISRLLLYSPEERMDVKTALKHPWFFMLDRP----- 3446
            .                ::.|.....|:|..:...:....|:..:|...:.|     ::|     
 Worm  4349 KLPTPAPELDVPARDQVKLKTAKPTRGKDLEAGEKVKLKTEKAKIKEIQQKP-----EQPKEEPI 4408

  Fly  3447 VYDHDYQIGTDRLRN---YYDHFRDWYANASCKNYFRRRRLSGCFQHPSKMVYPPGHVYTPENTP 3508
            |:....|:.|.:|..   ..|||          ...|.:.|.                .||....
 Worm  4409 VHKDAVQLKTQQLPKTGIKGDHF----------TVDREKDLK----------------ETPAVVK 4447

  Fly  3509 EPLPEPRIRAKREEVVSKYLH--PDYELGLIQSESHYQY----------GPDTYL-LQLRDVNFP 3560
            ..:.|.||..|.   :|..:|  .:|......::|...|          ..|.|| ::..|....
 Worm  4448 PVIEETRISNKS---ISNVVHESSEYTSSYASNQSRLTYQAYREHKESTSSDVYLSVETADSFSQ 4509

  Fly  3561 VRLREYMKVAHRRS---------PSFALNDSVDWSLPVIRERR---------------------- 3594
            |:..||...:.||.         |..........:.|.|.::.                      
 Worm  4510 VQRLEYSPRSPRRERIIGFHMIRPQPTKIGQSKQAPPTISQQLKPLQGELGKAAKFVIEFAGAAP 4574

  Fly  3595 -RFTDIMDEEIDDERTRSRISMYAANESYSIRRLRTELGPRLDEYT----EADAMIET------- 3647
             :.|.:.|.:......|:.|:....|.|..|.||...   ...|||    .|...:|:       
 Worm  4575 VKVTWLKDGKEIKSTFRTLITTTPTNSSLHIGRLENS---HAGEYTVRLENAAGTVESLANLTVA 4636

  Fly  3648 --QREGYPPFFREKPQTIAITENQPSHIHCFAVGDPKPCVQWFKNDMVLTESKRIKISVDEDGRS 3710
              ..:|..|.|..:...:.|.:|.|:...|...|:|||.:||||:...|....|.:: |:|.|..
 Worm  4637 PPTTQGKAPDFSARLNDLRIQQNGPAEFSCQIGGEPKPTIQWFKDGQPLPNDDRFQV-VEEGGAY 4700

  Fly  3711 ILRFEPALHFDVGVYKVVARNKVGQTVARCR-------------------------------IVV 3744
            .|:|...:..|.|:|::||:|.||:  |||:                               |||
 Worm  4701 KLKFSNIISTDAGIYEIVAKNGVGE--ARCKARLNVNLQKTGKGAEEGPRYEAPRFTSQIQPIVV 4763

  Fly  3745 ------------ATLPDA-------------PDSPEISANSGTEILLRWKQPRDD---------- 3774
                        :..||.             .|..|||.:.| |.:||....|::          
 Worm  4764 DEGKGAQFSAQFSGFPDPTIRWYRNNEPVKHADGYEISQSKG-EAILRISAARNEDVAEYKVEAS 4827

  Fly  3775 ---GHSTVLCYSLQYKLSNCDAWTTV--------------ADNIDHEFYLLHDLQPNTNYQFRLA 3822
               |.::.:...:....|...|.:|:              |.:..|....|.|:.....:..:.:
 Worm  4828 NPAGKASSVANLVLTPRSGRIAKSTISRGGSASYQSSDKAAADSPHFIAKLSDISARQGHTVKFS 4892

  Fly  3823 S------KNRIGWSEMGIPVSASTVGGDAPKIHITKAMKHLQQLTENGHQVVPEEERVHTD 3877
            :      :..:.|...|.|:|||                :..:::.:|.:.:.|..||..|
 Worm  4893 AEVDGNPEPTVQWQFKGKPISAS----------------NNVKISRDGKRAILELARVTPD 4937

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ObscNP_001097440.1 RhoGEF 90..260 CDD:238091 2/3 (67%)
PH_unc89 275..388 CDD:270134 31/160 (19%)
Not5 <477..>652 CDD:444384 34/202 (17%)
Ig 1017..1108 CDD:472250 24/101 (24%)
Ig strand B 1034..1038 CDD:409353 1/3 (33%)
Ig strand C 1046..1050 CDD:409353 0/3 (0%)
Ig strand E 1074..1078 CDD:409353 1/3 (33%)
Ig strand F 1088..1093 CDD:409353 2/4 (50%)
Ig strand G 1101..1104 CDD:409353 1/2 (50%)
I-set 1123..1212 CDD:400151 28/92 (30%)
Ig strand B 1140..1144 CDD:409353 0/3 (0%)
Ig strand C 1153..1157 CDD:409353 0/3 (0%)
Ig strand E 1182..1186 CDD:409353 1/3 (33%)
Ig strand F 1196..1201 CDD:409353 3/4 (75%)
Ig strand G 1209..1212 CDD:409353 0/2 (0%)
Ig <1236..1299 CDD:472250 22/89 (25%)
Ig strand C 1238..1242 CDD:409353 0/4 (0%)
Ig strand E 1259..1269 CDD:409353 3/9 (33%)
Ig strand F 1279..1284 CDD:409353 2/4 (50%)
Ig strand G 1292..1295 CDD:409353 1/20 (5%)
I-set 1313..1403 CDD:400151 22/93 (24%)
Ig strand B 1330..1334 CDD:409353 1/3 (33%)
Ig strand C 1343..1347 CDD:409353 0/3 (0%)
Ig strand E 1369..1373 CDD:409353 2/3 (67%)
Ig strand F 1383..1388 CDD:409353 2/4 (50%)
Ig strand G 1396..1399 CDD:409353 1/2 (50%)
Ig_3 1406..1487 CDD:464046 16/111 (14%)
I-set 1499..1595 CDD:400151 21/131 (16%)
Ig strand B 1522..1526 CDD:409353 1/5 (20%)
Ig strand C 1535..1539 CDD:409353 1/3 (33%)
Ig strand E 1561..1565 CDD:409353 1/3 (33%)
Ig strand F 1575..1580 CDD:409353 2/4 (50%)
Ig strand G 1588..1591 CDD:409353 0/2 (0%)
Ig 1599..1690 CDD:472250 23/135 (17%)
Ig strand B 1617..1621 CDD:409353 1/3 (33%)
Ig strand C 1630..1634 CDD:409353 1/3 (33%)
Ig strand E 1656..1660 CDD:409353 1/3 (33%)
Ig strand F 1670..1675 CDD:409353 1/4 (25%)
Ig strand G 1683..1686 CDD:409353 0/2 (0%)
I-set 1694..1786 CDD:400151 28/95 (29%)
Ig strand B 1711..1715 CDD:409353 1/3 (33%)
Ig strand C 1724..1728 CDD:409353 1/3 (33%)
Ig strand E 1752..1756 CDD:409353 1/3 (33%)
Ig strand F 1766..1771 CDD:409353 1/4 (25%)
Ig strand G 1779..1782 CDD:409353 0/2 (0%)
Ig <1836..1903 CDD:472250 23/68 (34%)
Ig strand C 1846..1850 CDD:409353 0/3 (0%)
Ig strand E 1871..1875 CDD:409353 1/3 (33%)
Ig strand F 1885..1890 CDD:409353 3/4 (75%)
Ig 1922..2005 CDD:472250 18/102 (18%)
Ig strand B 1933..1937 CDD:409353 0/3 (0%)
Ig strand C 1946..1950 CDD:409353 0/3 (0%)
Ig strand E 1971..1984 CDD:409353 2/13 (15%)
Ig strand F 1994..1999 CDD:409353 1/4 (25%)
Ig 2018..2108 CDD:472250 11/94 (12%)
Ig strand B 2034..2038 CDD:409353 0/3 (0%)
Ig strand C 2047..2051 CDD:409353 0/3 (0%)
Ig strand E 2074..2078 CDD:409353 1/3 (33%)
Ig strand F 2088..2093 CDD:409353 0/4 (0%)
Ig strand G 2101..2104 CDD:409353 0/2 (0%)
Ig 2113..2214 CDD:472250 27/123 (22%)
Ig strand B 2130..2134 CDD:409353 1/5 (20%)
Ig strand C 2143..2147 CDD:409353 1/9 (11%)
Ig strand E 2176..2185 CDD:409353 1/8 (13%)
Ig strand F 2195..2200 CDD:409353 3/4 (75%)
I-set 2220..2302 CDD:400151 25/83 (30%)
Ig strand B 2238..2242 CDD:409353 2/3 (67%)
Ig strand C 2251..2255 CDD:409353 1/3 (33%)
Ig strand E 2277..2281 CDD:409353 1/3 (33%)
Ig strand F 2291..2296 CDD:409353 2/4 (50%)
Ig strand G 2304..2307 CDD:409353 1/2 (50%)
I-set 2318..2408 CDD:400151 23/125 (18%)
Ig strand B 2335..2339 CDD:409353 0/3 (0%)
Ig strand C 2348..2352 CDD:409353 1/3 (33%)
Ig strand E 2374..2378 CDD:409353 1/3 (33%)
Ig strand F 2388..2393 CDD:409353 2/4 (50%)
Ig 2415..2506 CDD:472250 25/93 (27%)
Ig strand B 2432..2436 CDD:409353 0/5 (0%)
Ig strand C 2445..2449 CDD:409353 0/3 (0%)
Ig strand E 2472..2476 CDD:409353 0/3 (0%)
Ig strand F 2486..2491 CDD:409353 0/4 (0%)
Ig strand G 2499..2502 CDD:409353 1/2 (50%)
I-set 2519..2608 CDD:400151 28/117 (24%)
Ig strand B 2536..2540 CDD:409353 1/3 (33%)
Ig strand C 2549..2553 CDD:409353 1/3 (33%)
Ig strand E 2574..2578 CDD:409353 1/3 (33%)
Ig strand F 2588..2593 CDD:409353 2/4 (50%)
I-set 2615..2696 CDD:400151 21/94 (22%)
Ig strand B 2632..2636 CDD:409353 0/3 (0%)
Ig strand C 2645..2649 CDD:409353 1/7 (14%)
Ig strand E 2670..2674 CDD:409353 1/3 (33%)
Ig strand F 2684..2689 CDD:409353 2/4 (50%)
Ig strand G 2697..2700 CDD:409353 1/2 (50%)
I-set 2717..2805 CDD:400151 24/90 (27%)
Ig strand B 2734..2738 CDD:409353 1/3 (33%)
Ig strand C 2747..2751 CDD:409353 1/5 (20%)
Ig strand E 2773..2777 CDD:409353 1/3 (33%)
Ig strand F 2787..2792 CDD:409353 1/4 (25%)
Ig strand G 2800..2803 CDD:409353 0/2 (0%)
FN3 2834..2925 CDD:238020 22/159 (14%)
Ig <2996..3063 CDD:472250 21/68 (31%)
Ig strand C 3003..3007 CDD:409353 1/3 (33%)
Ig strand E 3029..3033 CDD:409353 2/3 (67%)
Ig strand F 3043..3048 CDD:409353 1/4 (25%)
Ig strand G 3056..3059 CDD:409353 0/2 (0%)
Ig 3067..3157 CDD:472250 25/121 (21%)
Ig strand B 3085..3088 CDD:409353 1/2 (50%)
Ig strand C 3097..3101 CDD:409353 1/3 (33%)
Ig strand E 3123..3127 CDD:409353 1/3 (33%)
Ig strand F 3137..3142 CDD:409353 0/4 (0%)
Ig strand G 3150..3153 CDD:409353 0/2 (0%)
PK_Unc-89_rpt1 3182..3440 CDD:271011 46/281 (16%)
Ig 3654..3744 CDD:472250 33/120 (28%)
Ig strand B 3671..3675 CDD:409353 0/3 (0%)
Ig strand C 3684..3688 CDD:409353 1/3 (33%)
Ig strand E 3710..3714 CDD:409353 1/3 (33%)
Ig strand F 3724..3729 CDD:409353 1/4 (25%)
Ig strand G 3737..3740 CDD:409353 1/2 (50%)
FN3 3748..3840 CDD:238020 24/137 (18%)
STKc_Unc-89_rpt2 3893..4151 CDD:271014
ketn-1NP_001294668.1 I-set 18..106 CDD:400151
Ig strand B 35..39 CDD:409353
Ig strand C 48..52 CDD:409353
Ig strand E 73..77 CDD:409353
Ig strand F 87..92 CDD:409353
I-set 136..224 CDD:400151
Ig strand B 153..157 CDD:409353
Ig strand C 166..170 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 206..211 CDD:409353
Ig strand G 219..222 CDD:409353
I-set 303..393 CDD:400151
Ig strand B 320..324 CDD:409353
Ig strand C 333..337 CDD:409353
Ig strand E 359..363 CDD:409353
Ig strand F 373..378 CDD:409353
Ig strand G 386..389 CDD:409353
I-set 706..797 CDD:400151 20/102 (20%)
Ig strand B 723..727 CDD:409353 1/3 (33%)
Ig strand C 736..740 CDD:409353 0/3 (0%)
Ig strand E 763..767 CDD:409353 3/3 (100%)
Ig strand F 777..782 CDD:409353 0/4 (0%)
Ig strand G 790..793 CDD:409353 1/2 (50%)
I-set 806..894 CDD:400151 15/97 (15%)
Ig strand B 823..827 CDD:409353 0/3 (0%)
Ig strand C 835..839 CDD:409353 0/3 (0%)
Ig strand E 860..864 CDD:409353 0/3 (0%)
Ig strand F 874..879 CDD:409353 0/4 (0%)
Ig strand G 887..890 CDD:409353 2/11 (18%)
Ig 937..1028 CDD:472250 21/130 (16%)
Ig strand B 954..958 CDD:409353 1/3 (33%)
Ig strand C 967..973 CDD:409353 0/5 (0%)
Ig strand E 994..998 CDD:409353 2/14 (14%)
Ig strand F 1008..1013 CDD:409353 2/4 (50%)
Ig strand G 1021..1024 CDD:409353 2/14 (14%)
Ig 1065..1156 CDD:472250 23/129 (18%)
Ig strand B 1082..1086 CDD:409353 1/3 (33%)
Ig strand C 1095..1101 CDD:409353 1/31 (3%)
Ig strand E 1122..1126 CDD:409353 3/3 (100%)
Ig strand F 1136..1141 CDD:409353 0/4 (0%)
Ig strand G 1149..1152 CDD:409353 0/2 (0%)
Ig 1190..1281 CDD:472250 22/112 (20%)
Ig strand B 1208..1212 CDD:409353 0/3 (0%)
Ig strand C 1223..1227 CDD:409353 0/3 (0%)
Ig strand E 1248..1252 CDD:409353 0/3 (0%)
Ig strand F 1262..1267 CDD:409353 0/4 (0%)
Ig strand G 1275..1278 CDD:409353 0/2 (0%)
Ig 1328..1420 CDD:472250 21/104 (20%)
Ig strand B 1346..1350 CDD:409353 1/3 (33%)
Ig strand C 1361..1365 CDD:409353 0/3 (0%)
Ig strand E 1386..1390 CDD:409353 0/3 (0%)
Ig strand F 1400..1405 CDD:409353 1/4 (25%)
Ig strand G 1413..1416 CDD:409353 2/2 (100%)
Ig 1462..1554 CDD:472250 22/94 (23%)
Ig strand C 1494..1498 CDD:409353 0/3 (0%)
Ig strand E 1517..1523 CDD:409353 1/5 (20%)
Ig strand F 1533..1538 CDD:409353 2/4 (50%)
Ig strand G 1546..1549 CDD:409353 0/2 (0%)
Ig 1595..1685 CDD:472250 29/95 (31%)
Ig strand B 1614..1618 CDD:409353 0/3 (0%)
Ig strand C 1629..1633 CDD:409353 0/3 (0%)
Ig strand E 1654..1658 CDD:409353 1/3 (33%)
Ig strand F 1668..1673 CDD:409353 3/4 (75%)
Ig strand G 1682..1685 CDD:409353 0/2 (0%)
Ig 1728..1816 CDD:472250 21/91 (23%)
Ig strand B 1746..1750 CDD:409353 1/5 (20%)
Ig strand C 1759..1765 CDD:409353 0/5 (0%)
Ig strand E 1786..1790 CDD:409353 2/3 (67%)
Ig strand F 1800..1805 CDD:409353 2/4 (50%)
Ig strand G 1813..1816 CDD:409353 1/2 (50%)
Ig 1873..1953 CDD:472250 19/80 (24%)
Ig strand E 1919..1923 CDD:409353 2/3 (67%)
Ig strand F 1933..1938 CDD:409353 2/4 (50%)
Ig strand G 1946..1949 CDD:409353 1/2 (50%)
I-set 1993..2085 CDD:400151 17/96 (18%)
Ig strand B 2012..2016 CDD:409353 1/3 (33%)
Ig strand C 2027..2031 CDD:409353 0/3 (0%)
Ig strand E 2049..2056 CDD:409353 2/10 (20%)
Ig strand F 2066..2071 CDD:409353 1/4 (25%)
Ig strand G 2079..2082 CDD:409353 1/2 (50%)
I-set 2126..2217 CDD:400151 19/93 (20%)
Ig strand B 2144..2148 CDD:409353 1/3 (33%)
Ig strand C 2159..2163 CDD:409353 1/3 (33%)
Ig strand E 2185..2188 CDD:409353 1/2 (50%)
Ig strand F 2198..2203 CDD:409353 2/4 (50%)
Ig strand G 2211..2214 CDD:409353 1/2 (50%)
Ig 2258..2351 CDD:472250 13/96 (14%)
Ig strand B 2277..2281 CDD:409353 1/7 (14%)
Ig strand C 2288..2296 CDD:409353 2/7 (29%)
Ig strand E 2317..2321 CDD:409353 2/3 (67%)
Ig strand F 2331..2336 CDD:409353 1/4 (25%)
Ig strand G 2344..2347 CDD:409353 0/2 (0%)
I-set 2391..2482 CDD:400151 28/95 (29%)
Ig strand B 2408..2412 CDD:409353 1/3 (33%)
Ig strand C 2423..2427 CDD:409353 1/3 (33%)
Ig strand E 2449..2452 CDD:409353 1/2 (50%)
Ig strand F 2462..2467 CDD:409353 1/4 (25%)
Ig strand G 2475..2478 CDD:409353 0/2 (0%)
Ig 2522..2612 CDD:472250 29/89 (33%)
Ig strand B 2540..2544 CDD:409353 0/3 (0%)
Ig strand C 2553..2559 CDD:409353 1/5 (20%)
Ig strand E 2580..2584 CDD:409353 1/3 (33%)
Ig strand F 2594..2599 CDD:409353 3/4 (75%)
Ig strand G 2607..2610 CDD:409353 0/2 (0%)
Ig 2654..2746 CDD:472250 21/101 (21%)
Ig strand B 2672..2676 CDD:409353 2/3 (67%)
Ig strand C 2687..2691 CDD:409353 0/3 (0%)
Ig strand E 2712..2716 CDD:409353 1/3 (33%)
Ig strand F 2726..2731 CDD:409353 1/4 (25%)
Ig strand G 2739..2742 CDD:409353 2/2 (100%)
Ig 2799..2878 CDD:472250 21/99 (21%)
Ig strand B 2805..2809 CDD:409353 1/3 (33%)
Ig strand C 2820..2824 CDD:409353 1/3 (33%)
Ig strand E 2845..2849 CDD:409353 1/3 (33%)
Ig strand F 2859..2864 CDD:409353 3/4 (75%)
Ig strand G 2872..2875 CDD:409353 0/2 (0%)
Ig 2919..3011 CDD:472250 28/92 (30%)
Ig strand C 2952..2956 CDD:409353 1/3 (33%)
Ig strand E 2977..2981 CDD:409353 1/3 (33%)
Ig strand F 2991..2996 CDD:409353 2/4 (50%)
Ig 3051..3141 CDD:472250 21/90 (23%)
Ig strand B 3068..3072 CDD:409353 0/3 (0%)
Ig strand C 3083..3087 CDD:409353 1/3 (33%)
Ig strand E 3108..3112 CDD:409353 1/3 (33%)
Ig strand F 3122..3127 CDD:409353 2/4 (50%)
Ig strand G 3135..3138 CDD:409353 0/2 (0%)
Ig 3182..3274 CDD:472250 25/93 (27%)
Ig strand B 3200..3204 CDD:409353 0/3 (0%)
Ig strand C 3213..3219 CDD:409353 0/5 (0%)
Ig strand E 3240..3244 CDD:409353 0/3 (0%)
Ig strand F 3254..3259 CDD:409353 0/4 (0%)
Ig strand G 3267..3270 CDD:409353 1/2 (50%)
Ig 3328..3406 CDD:472250 23/77 (30%)
Ig strand C 3347..3351 CDD:409353 1/3 (33%)
Ig strand E 3372..3376 CDD:409353 1/3 (33%)
Ig strand F 3386..3391 CDD:409353 2/4 (50%)
Ig 3448..3539 CDD:472250 21/90 (23%)
Ig strand C 3481..3485 CDD:409353 0/3 (0%)
Ig strand E 3506..3510 CDD:409353 1/3 (33%)
Ig strand F 3520..3525 CDD:409353 2/4 (50%)
I-set 3584..3676 CDD:400151 26/92 (28%)
Ig strand B 3602..3606 CDD:409353 1/3 (33%)
Ig strand C 3617..3621 CDD:409353 1/3 (33%)
Ig strand E 3642..3646 CDD:409353 1/3 (33%)
Ig strand F 3656..3661 CDD:409353 1/4 (25%)
Ig 3720..3806 CDD:472250 16/90 (18%)
Ig strand B 3738..3742 CDD:409353 0/3 (0%)
Ig strand C 3753..3757 CDD:409353 0/3 (0%)
Ig strand E 3778..3782 CDD:409353 1/3 (33%)
Ig strand F 3792..3797 CDD:409353 0/4 (0%)
Ig 3821..3914 CDD:472250 10/92 (11%)
Ig strand B 3840..3844 CDD:409353 0/3 (0%)
Ig strand C 3855..3859 CDD:409353 1/3 (33%)
Ig strand E 3880..3884 CDD:409353 1/3 (33%)
Ig strand F 3894..3899 CDD:409353 1/4 (25%)
Ig 3962..4052 CDD:472250 27/92 (29%)
Ig strand B 3979..3983 CDD:409353 0/3 (0%)
Ig strand C 3994..3998 CDD:409353 1/3 (33%)
Ig strand E 4019..4023 CDD:409353 2/3 (67%)
Ig strand F 4033..4038 CDD:409353 1/4 (25%)
Ig strand G 4046..4049 CDD:409353 0/2 (0%)
I-set 4098..4184 CDD:400151 20/87 (23%)
Ig strand B 4115..4119 CDD:409353 1/3 (33%)
Ig strand C 4128..4132 CDD:409353 1/3 (33%)
Ig strand E 4152..4156 CDD:409353 1/3 (33%)
Ig strand F 4166..4171 CDD:409353 0/4 (0%)
Ig strand G 4179..4182 CDD:409353 0/2 (0%)
Ig 4546..4635 CDD:472250 16/91 (18%)
Ig strand B 4563..4567 CDD:409353 0/3 (0%)
Ig strand C 4576..4580 CDD:409353 1/3 (33%)
Ig strand E 4601..4605 CDD:409353 1/3 (33%)
Ig strand F 4615..4620 CDD:409353 3/4 (75%)
Ig strand G 4628..4633 CDD:409353 1/4 (25%)
I-set 4645..4734 CDD:400151 32/91 (35%)
Ig strand B 4662..4666 CDD:409353 0/3 (0%)
Ig strand C 4675..4679 CDD:409353 1/3 (33%)
Ig strand E 4700..4704 CDD:409353 1/3 (33%)
Ig strand F 4714..4719 CDD:409353 1/4 (25%)
Ig strand G 4727..4730 CDD:409353 2/2 (100%)
I-set 4752..4839 CDD:400151 15/87 (17%)
Ig strand B 4769..4773 CDD:409353 0/3 (0%)
Ig strand C 4782..4786 CDD:409353 0/3 (0%)
Ig strand E 4807..4811 CDD:409353 1/3 (33%)
Ig strand F 4821..4826 CDD:409353 0/4 (0%)
Ig strand G 4834..4837 CDD:409353 0/2 (0%)
I-set 4872..4960 CDD:400151 14/82 (17%)
Ig strand B 4889..4893 CDD:409353 0/3 (0%)
Ig strand C 4902..4906 CDD:409353 0/3 (0%)
Ig strand E 4927..4931 CDD:409353 0/3 (0%)
Ig strand F 4941..4946 CDD:409353
Ig strand G 4954..4957 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.