DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obsc and unc-22

DIOPT Version :10

Sequence 1:NP_001097440.1 Gene:Obsc / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:NP_502274.2 Gene:unc-22 / 178135 WormBaseID:WBGene00006759 Length:7158 Species:Caenorhabditis elegans


Alignment Length:67 Identity:15/67 - (22%)
Similarity:25/67 - (37%) Gaps:21/67 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 DVAFSNNG--QLKGHIRIHTG------ERP-------------FKCDEPSCSKTFTRNEELTRHK 229
            :|.|:|:|  :||..:.:..|      .||             .|.:|.......:|.::..|..
 Worm   711 NVKFTNDGVERLKVDMEVLYGVFRTWCVRPEGFFPKLSEGLTLLKMEEKQVKDGLSRGDKWLREN 775

  Fly   230 RI 231
            ||
 Worm   776 RI 777

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ObscNP_001097440.1 RhoGEF 90..260 CDD:238091 15/67 (22%)
PH_unc89 275..388 CDD:270134
Not5 <477..>652 CDD:444384
Ig 1017..1108 CDD:472250
Ig strand B 1034..1038 CDD:409353
Ig strand C 1046..1050 CDD:409353
Ig strand E 1074..1078 CDD:409353
Ig strand F 1088..1093 CDD:409353
Ig strand G 1101..1104 CDD:409353
I-set 1123..1212 CDD:400151
Ig strand B 1140..1144 CDD:409353
Ig strand C 1153..1157 CDD:409353
Ig strand E 1182..1186 CDD:409353
Ig strand F 1196..1201 CDD:409353
Ig strand G 1209..1212 CDD:409353
Ig <1236..1299 CDD:472250
Ig strand C 1238..1242 CDD:409353
Ig strand E 1259..1269 CDD:409353
Ig strand F 1279..1284 CDD:409353
Ig strand G 1292..1295 CDD:409353
I-set 1313..1403 CDD:400151
Ig strand B 1330..1334 CDD:409353
Ig strand C 1343..1347 CDD:409353
Ig strand E 1369..1373 CDD:409353
Ig strand F 1383..1388 CDD:409353
Ig strand G 1396..1399 CDD:409353
Ig_3 1406..1487 CDD:464046
I-set 1499..1595 CDD:400151
Ig strand B 1522..1526 CDD:409353
Ig strand C 1535..1539 CDD:409353
Ig strand E 1561..1565 CDD:409353
Ig strand F 1575..1580 CDD:409353
Ig strand G 1588..1591 CDD:409353
Ig 1599..1690 CDD:472250
Ig strand B 1617..1621 CDD:409353
Ig strand C 1630..1634 CDD:409353
Ig strand E 1656..1660 CDD:409353
Ig strand F 1670..1675 CDD:409353
Ig strand G 1683..1686 CDD:409353
I-set 1694..1786 CDD:400151
Ig strand B 1711..1715 CDD:409353
Ig strand C 1724..1728 CDD:409353
Ig strand E 1752..1756 CDD:409353
Ig strand F 1766..1771 CDD:409353
Ig strand G 1779..1782 CDD:409353
Ig <1836..1903 CDD:472250
Ig strand C 1846..1850 CDD:409353
Ig strand E 1871..1875 CDD:409353
Ig strand F 1885..1890 CDD:409353
Ig 1922..2005 CDD:472250
Ig strand B 1933..1937 CDD:409353
Ig strand C 1946..1950 CDD:409353
Ig strand E 1971..1984 CDD:409353
Ig strand F 1994..1999 CDD:409353
Ig 2018..2108 CDD:472250
Ig strand B 2034..2038 CDD:409353
Ig strand C 2047..2051 CDD:409353
Ig strand E 2074..2078 CDD:409353
Ig strand F 2088..2093 CDD:409353
Ig strand G 2101..2104 CDD:409353
Ig 2113..2214 CDD:472250
Ig strand B 2130..2134 CDD:409353
Ig strand C 2143..2147 CDD:409353
Ig strand E 2176..2185 CDD:409353
Ig strand F 2195..2200 CDD:409353
I-set 2220..2302 CDD:400151
Ig strand B 2238..2242 CDD:409353
Ig strand C 2251..2255 CDD:409353
Ig strand E 2277..2281 CDD:409353
Ig strand F 2291..2296 CDD:409353
Ig strand G 2304..2307 CDD:409353
I-set 2318..2408 CDD:400151
Ig strand B 2335..2339 CDD:409353
Ig strand C 2348..2352 CDD:409353
Ig strand E 2374..2378 CDD:409353
Ig strand F 2388..2393 CDD:409353
Ig 2415..2506 CDD:472250
Ig strand B 2432..2436 CDD:409353
Ig strand C 2445..2449 CDD:409353
Ig strand E 2472..2476 CDD:409353
Ig strand F 2486..2491 CDD:409353
Ig strand G 2499..2502 CDD:409353
I-set 2519..2608 CDD:400151
Ig strand B 2536..2540 CDD:409353
Ig strand C 2549..2553 CDD:409353
Ig strand E 2574..2578 CDD:409353
Ig strand F 2588..2593 CDD:409353
I-set 2615..2696 CDD:400151
Ig strand B 2632..2636 CDD:409353
Ig strand C 2645..2649 CDD:409353
Ig strand E 2670..2674 CDD:409353
Ig strand F 2684..2689 CDD:409353
Ig strand G 2697..2700 CDD:409353
I-set 2717..2805 CDD:400151
Ig strand B 2734..2738 CDD:409353
Ig strand C 2747..2751 CDD:409353
Ig strand E 2773..2777 CDD:409353
Ig strand F 2787..2792 CDD:409353
Ig strand G 2800..2803 CDD:409353
FN3 2834..2925 CDD:238020
Ig <2996..3063 CDD:472250
Ig strand C 3003..3007 CDD:409353
Ig strand E 3029..3033 CDD:409353
Ig strand F 3043..3048 CDD:409353
Ig strand G 3056..3059 CDD:409353
Ig 3067..3157 CDD:472250
Ig strand B 3085..3088 CDD:409353
Ig strand C 3097..3101 CDD:409353
Ig strand E 3123..3127 CDD:409353
Ig strand F 3137..3142 CDD:409353
Ig strand G 3150..3153 CDD:409353
PK_Unc-89_rpt1 3182..3440 CDD:271011
Ig 3654..3744 CDD:472250
Ig strand B 3671..3675 CDD:409353
Ig strand C 3684..3688 CDD:409353
Ig strand E 3710..3714 CDD:409353
Ig strand F 3724..3729 CDD:409353
Ig strand G 3737..3740 CDD:409353
FN3 3748..3840 CDD:238020
STKc_Unc-89_rpt2 3893..4151 CDD:271014
unc-22NP_502274.2 Ig 5..96 CDD:472250
Ig strand B 22..25 CDD:409353
Ig strand C 34..38 CDD:409353
Ig strand E 64..68 CDD:409353
Ig strand F 78..83 CDD:409353
Ig strand G 91..94 CDD:409353
Ig 111..196 CDD:472250
Ig strand B 128..132 CDD:409353
Ig strand C 141..145 CDD:409353
Ig strand E 171..175 CDD:409353
Ig strand F 185..190 CDD:409353
IG_like 384..467 CDD:214653
Ig strand B 395..399 CDD:409353
Ig strand C 408..412 CDD:409353
Ig strand E 433..437 CDD:409353
Ig strand F 447..452 CDD:409353
I-set 980..1071 CDD:400151
Ig strand B 997..1001 CDD:409353
Ig strand C 1010..1014 CDD:409353
Ig strand E 1035..1039 CDD:409353
Ig strand F 1051..1056 CDD:409353
Ig strand G 1064..1067 CDD:409353
Ig 1150..1214 CDD:409353
Ig strand C 1158..1162 CDD:409353
Ig strand E 1184..1188 CDD:409353
Ig strand F 1198..1203 CDD:409353
Ig strand G 1211..1214 CDD:409353
Ig 1239..1309 CDD:409353
Ig strand B 1239..1243 CDD:409353
Ig strand C 1252..1255 CDD:409353
Ig strand E 1278..1282 CDD:409353
Ig strand F 1292..1297 CDD:409353
Ig strand G 1306..1309 CDD:409353
Ig 1331..1399 CDD:472250
Ig strand B 1331..1335 CDD:409353
Ig strand C 1343..1347 CDD:409353
Ig strand E 1369..1373 CDD:409353
Ig strand F 1383..1388 CDD:409353
Ig strand G 1392..1395 CDD:409353
Ig 1404..>1474 CDD:472250
Ig 1505..1591 CDD:472250
Ig strand B 1513..1517 CDD:409353
Ig strand C 1530..1534 CDD:409353
Ig strand E 1557..1561 CDD:409353
Ig strand F 1571..1576 CDD:409353
Ig strand G 1584..1587 CDD:409353
FN3 <1602..>1775 CDD:442628
Ig 1808..1885 CDD:472250
Ig strand B 1813..1817 CDD:409353
Ig strand C 1826..1830 CDD:409353
Ig strand E 1851..1855 CDD:409353
Ig strand F 1865..1870 CDD:409353
FN3 <1866..>2080 CDD:442628
Ig strand G 1880..1883 CDD:409353
FN3 1992..2080 CDD:238020
Ig 2101..2182 CDD:472250
Ig strand B 2109..2113 CDD:409353
Ig strand C 2122..2126 CDD:409353
Ig strand E 2148..2152 CDD:409353
Ig strand F 2162..2167 CDD:409353
FN3 <2163..>2382 CDD:442628
Ig strand G 2177..2180 CDD:409353
FN3 2286..2376 CDD:238020
Ig 2396..2476 CDD:472250
Ig strand B 2405..2409 CDD:409353
Ig strand C 2418..2422 CDD:409353
Ig strand E 2442..2446 CDD:409353
Ig strand F 2456..2461 CDD:409353
Ig strand G 2469..2472 CDD:409353
FN3 2480..2571 CDD:238020
FN3 2580..2667 CDD:238020
Ig 2690..2768 CDD:472250
Ig strand B 2697..2701 CDD:409353
Ig strand C 2710..2714 CDD:409353
Ig strand E 2734..2738 CDD:409353
Ig strand F 2748..2753 CDD:409353
Ig strand G 2761..2764 CDD:409353
FN3 2772..2861 CDD:238020
FN3 2884..>3273 CDD:442628
Ig 3279..3359 CDD:472250
Ig strand B 3287..3291 CDD:409353
Ig strand C 3300..3304 CDD:409353
Ig strand E 3325..3329 CDD:409353
Ig strand F 3339..3344 CDD:409353
Ig strand G 3352..3355 CDD:409353
FN3 3363..3454 CDD:238020
FN3 3464..3552 CDD:238020
FN3 <3600..3952 CDD:442628
FN3 3951..4042 CDD:238020
FN3 4051..4138 CDD:238020
FN3 4136..>4682 CDD:442628
FN3 4431..4916 CDD:442628
FN3 <4862..>5133 CDD:442628
Ig 5144..5225 CDD:472250
Ig strand B 5152..5156 CDD:409353
Ig strand C 5165..5169 CDD:409353
Ig strand E 5191..5195 CDD:409353
Ig strand F 5205..5210 CDD:409353
Ig strand G 5218..5221 CDD:409353
FN3 5229..5323 CDD:238020
FN3 5331..5420 CDD:238020
FN3 5431..5520 CDD:238020
I-set 5533..5622 CDD:400151
Ig strand B 5550..5554 CDD:409353
Ig strand C 5563..5567 CDD:409353
Ig strand E 5588..5592 CDD:409353
Ig strand F 5602..5607 CDD:409353
Ig strand G 5615..5618 CDD:409353
FN3 <5696..>5904 CDD:442628
I-set 5923..6010 CDD:400151
Ig strand B 5940..5944 CDD:409353
Ig strand C 5953..5957 CDD:409353
Ig strand E 5978..5982 CDD:409353
Ig strand F 5992..5997 CDD:409353
Ig 6033..6108 CDD:472250
Ig strand B 6036..6040 CDD:409353
Ig strand C 6049..6053 CDD:409353
Ig strand E 6074..6078 CDD:409353
Ig strand F 6088..6093 CDD:409353
Ig strand G 6101..6104 CDD:409353
FN3 6112..6199 CDD:238020
STKc_Twitchin_like 6258..6516 CDD:271016
IgI_Twitchin_like 6586..6674 CDD:409541
Ig strand A 6586..6589 CDD:409541
Ig strand A' 6593..6597 CDD:409541
Ig strand B 6600..6607 CDD:409541
Ig strand C 6615..6620 CDD:409541
Ig strand C' 6622..6625 CDD:409541
Ig strand D 6631..6636 CDD:409541
Ig strand E 6639..6644 CDD:409541
Ig strand F 6653..6661 CDD:409541
Ig strand G 6664..6674 CDD:409541
I-set 6708..6796 CDD:400151
Ig strand C 6738..6742 CDD:409353
Ig strand E 6762..6766 CDD:409353
Ig strand F 6776..6781 CDD:409353
Ig strand G 6790..6793 CDD:409353
I-set 6863..6953 CDD:400151
Ig strand B 6880..6884 CDD:409570
Ig strand C 6893..6897 CDD:409570
Ig strand E 6919..6923 CDD:409570
Ig strand F 6933..6938 CDD:409570
Ig strand G 6946..6949 CDD:409570
Ig 6983..>7041 CDD:472250
Ig strand B 6989..6993 CDD:409353
Ig strand C 7002..7006 CDD:409353
Ig strand E 7024..7030 CDD:409353
Ig strand F 7040..7045 CDD:409353
Ig 7067..7142 CDD:472250
Ig strand C 7097..7101 CDD:409353
Ig strand E 7120..7126 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.