DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Unc-89 and Camk1g

DIOPT Version :9

Sequence 1:NP_001097440.1 Gene:Unc-89 / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:NP_878262.1 Gene:Camk1g / 171358 RGDID:621800 Length:476 Species:Rattus norvegicus


Alignment Length:331 Identity:98/331 - (29%)
Similarity:171/331 - (51%) Gaps:20/331 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  3192 LGRGTQGITYHAVERSSGDNYAAKIMYGRPELRPFML-NELEMMNTFNHKNLIRPYDAYDTDRSV 3255
            ||.|.....:...:|.:|..:|.|.:...|..|...| ||:.::....|:|::...|.|::....
  Rat    29 LGSGAFSEVFLVKQRVTGKLFALKCIKKSPAFRDSSLENEIAVLKRIKHENIVTLEDIYESTTHY 93

  Fly  3256 TLIMELAAGGELVRDNLLRRDYYTERDIAHYIRQTLWGLEHMHEMGVGHMGLTIKDLL-ISVVGG 3319
            .|:|:|.:||||. |.:|.|..|||:|.:..|:|.|..::::||.|:.|..|..::|| ::....
  Rat    94 YLVMQLVSGGELF-DRILERGVYTEKDASLVIQQVLSAVKYLHENGIVHRDLKPENLLYLTPEEN 157

  Fly  3320 DIIKVSDFGLSRKINRHNLSTLDYGMPEFVSPEVVNKEGVNFSHDMWTVGLITYVLLGGHNPFLG 3384
            ..|.::||||| |:.::.:.:...|.|.:|:|||:.::..:.:.|.|::|:|||:||.|:.||..
  Rat   158 SKIMITDFGLS-KMEQNGVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVITYILLCGYPPFYE 221

  Fly  3385 IDDRETLTKIREGRWDFKDEIWTHISDDGRDFISRLLLYSPEERMDVKTALKHPWF---FMLDRP 3446
            ..:.:...||:||.::|:...|..||:..:|||..||...|.||...:.||:|||.   ..|.|.
  Rat   222 ETESKLFEKIKEGYYEFESPFWDDISESAKDFICHLLEKDPNERYTCEKALRHPWIDGNTALHRD 286

  Fly  3447 VYDHDYQIGTDRLRNY-YDHFRDWYANASCKNYFRRRRLSGCFQHPSKMVYPPGHVYTPENTPEP 3510
            :|.   .:.....:|: ...:|..:..|:..::.|:..::         ::.|......||.|..
  Rat   287 IYP---SVSLQIQKNFAKSKWRQAFNAAAVVHHMRKLHMN---------LHSPSVRQEVENRPPV 339

  Fly  3511 LPEPRI 3516
            .|.|.:
  Rat   340 SPAPEV 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Unc-89NP_001097440.1 RhoGEF 90..260 CDD:238091
PH_unc89 275..388 CDD:270134
Atrophin-1 <493..690 CDD:331285
TonB_N 502..>596 CDD:318287
I-set 1017..1108 CDD:333254
I-set 1123..1212 CDD:254352
I-set <1236..1299 CDD:333254
I-set 1313..1403 CDD:254352
Ig_3 1406..1487 CDD:316449
I-set 1499..1595 CDD:254352
I-set 1599..1690 CDD:333254
I-set 1694..1786 CDD:254352
I-set <1836..1903 CDD:333254
I-set 1922..2005 CDD:333254
I-set 2018..2108 CDD:333254
I-set 2113..2214 CDD:333254
I-set 2220..2302 CDD:254352
I-set 2318..2408 CDD:254352
I-set 2415..2506 CDD:254352
I-set 2519..2608 CDD:254352
I-set 2615..2696 CDD:254352
I-set 2717..2805 CDD:254352
FN3 2834..2925 CDD:238020
I-set <2996..3063 CDD:333254
I-set 3067..3157 CDD:333254
PK_Unc-89_rpt1 3182..3440 CDD:271011 84/249 (34%)
I-set 3654..3744 CDD:333254
FN3 3748..3840 CDD:238020
STKc_Unc-89_rpt2 3893..4151 CDD:271014
Camk1gNP_878262.1 STKc_CaMKI_gamma 19..303 CDD:271068 89/278 (32%)
S_TKc 23..277 CDD:214567 84/249 (34%)
Autoinhibitory domain 277..317 6/42 (14%)
Calmodulin-binding 297..318 3/20 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 326..387 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.