DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Unc-89 and CAPSL

DIOPT Version :9

Sequence 1:NP_001097440.1 Gene:Unc-89 / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:XP_006714507.1 Gene:CAPSL / 133690 HGNCID:28375 Length:225 Species:Homo sapiens


Alignment Length:223 Identity:48/223 - (21%)
Similarity:89/223 - (39%) Gaps:51/223 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1564 KITGATRVDAGKYTVKATNEHGSATSSTQ-LLIKCAPEFTHKLKNI----TVAEGDSN-----VE 1618
            |:.|..|.|. :..::|..:..:||...: |.::|....:..:|.:    .:.:.|:|     .|
Human    17 KMAGTARHDR-EMAIQAKKKLTTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKE 80

  Fly  1619 LVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVE-EGN---DFKLIMNQVATNMQGNYTCKIMNDY 1679
            .:.|::.|...        :|.:|....||..: :||   ||...:..:...|.......||..:
Human    81 FMKGLNDYAVV--------MEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAF 137

  Fly  1680 GKLE--DNCVVTV-------NCK--PKVKRGLKNVEVQEGKSFTLEVEVYSEPEAKIKWFKDGHE 1733
            .||:  .:.|:|:       |.|  ||.:.|    |..|.:.|...::.:..|     :.|||..
Human   138 RKLDKTGDGVITIEDLREVYNAKHHPKYQNG----EWSEEQVFRKFLDNFDSP-----YDKDGLV 193

  Fly  1734 IYED-----ARIKISRDTQRIENYYLTL 1756
            ..|:     |.:..|.||   :.|::.:
Human   194 TPEEFMNYYAGVSASIDT---DVYFIIM 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Unc-89NP_001097440.1 RhoGEF 90..260 CDD:238091
PH_unc89 275..388 CDD:270134
Atrophin-1 <493..690 CDD:331285
TonB_N 502..>596 CDD:318287
I-set 1017..1108 CDD:333254
I-set 1123..1212 CDD:254352
I-set <1236..1299 CDD:333254
I-set 1313..1403 CDD:254352
Ig_3 1406..1487 CDD:316449
I-set 1499..1595 CDD:254352 8/31 (26%)
I-set 1599..1690 CDD:333254 20/105 (19%)
I-set 1694..1786 CDD:254352 16/68 (24%)
I-set <1836..1903 CDD:333254
I-set 1922..2005 CDD:333254
I-set 2018..2108 CDD:333254
I-set 2113..2214 CDD:333254
I-set 2220..2302 CDD:254352
I-set 2318..2408 CDD:254352
I-set 2415..2506 CDD:254352
I-set 2519..2608 CDD:254352
I-set 2615..2696 CDD:254352
I-set 2717..2805 CDD:254352
FN3 2834..2925 CDD:238020
I-set <2996..3063 CDD:333254
I-set 3067..3157 CDD:333254
PK_Unc-89_rpt1 3182..3440 CDD:271011
I-set 3654..3744 CDD:333254
FN3 3748..3840 CDD:238020
STKc_Unc-89_rpt2 3893..4151 CDD:271014
CAPSLXP_006714507.1 EF-hand_7 61..118 CDD:290234 13/64 (20%)
EFh 63..118 CDD:238008 13/62 (21%)
EF-hand_7 100..157 CDD:290234 13/56 (23%)
EFh 101..155 CDD:238008 13/53 (25%)
EF-hand_7 133..202 CDD:290234 19/77 (25%)
EFh 133..199 CDD:298682 19/74 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.