DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Unc-89 and hmcn2

DIOPT Version :9

Sequence 1:NP_001097440.1 Gene:Unc-89 / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:XP_031747766.1 Gene:hmcn2 / 100490941 XenbaseID:XB-GENE-6034990 Length:4625 Species:Xenopus tropicalis


Alignment Length:4063 Identity:830/4063 - (20%)
Similarity:1375/4063 - (33%) Gaps:1261/4063 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 PIQRIND--YQLLFKDFIKYSLSLKENVKDL-ERALELMLSVPSR--------------AYDNRF 266
            |.||::.  |..:..|.  .::.:.|.::.. ||.|.|..||.|.              ..|..|
 Frog   401 PFQRLSSVAYTSIIPDI--PTVFMPELIQGYHERLLRLTCSVLSEIPFRLRFSKDGERLGEDQFF 463

  Fly   267 LSSIEGCRGNIYKLGRLLLHAW--------------CNVVDKEGKAHDRYCFLFKSRILVTKVRK 317
            :.|     ||.         .|              |..:.|.|..:.|           |||..
 Frog   464 MES-----GNA---------TWEIPSASARHEGTYLCTAMSKAGGGYAR-----------TKVSV 503

  Fly   318 ISENRSVFILQNIV------KLPLCNI--ELKADEKQIH--------------------LSLKAP 354
            .....::.:..||.      .:..|.:  |::.:....|                    |:.:|.
 Frog   504 ADPPPTLAVTHNITTFVGGSAILSCEVLGEIRYNLTWAHSGKAFREGRVRILANSSLEILNAQAS 568

  Fly   355 EANSFLPIDIKPHGPEAHLTWFNEISSHINQDVTLQEHNADDLKVDASQIASESELILH------ 413
            :|..:.......||......|           :|:|...:.::|..:.|::...|:.|.      
 Frog   569 DAGEYQCTASNDHGATTASLW-----------LTIQAPPSIEIKSSSMQLSHGEEVTLRCDVSGN 622

  Fly   414 -LPQRAEAHDPNLSVRPSDVAENYFLSKETKERLQHEQQELLK-LEQEAIELYKKQQSSKSVSSK 476
             :||.:..|            |:.|||..::..:......|:| ..||....| ...:|.|:.:.
 Frog   623 PVPQVSWKH------------EDSFLSNGSRYTVLDNSTLLIKDAGQEDAGNY-SCVASNSLGTD 674

  Fly   477 TESVEITSSQVKSSSEVRKVVSPPPPPQAQVKEVTPVKVVSSPPPPKEITPAKVATPPPQPQVVT 541
            .::|.:|..:...::.|:.:|..|      :.|...::.:|...||..:|..|            
 Frog   675 EQTVFLTYVERPKATAVKALVLVP------LGEDAILECLSEGLPPPVVTWYK------------ 721

  Fly   542 SPVKEVAPPPQPRAVASPAKEVTPSQSEPVKAPSPIKEVRKEVPPSASHSKEVEALVATEIRESL 606
                             ..||||.::|........::|||.|       .....|.||:.     
 Frog   722 -----------------DDKEVTGTESGTNGGTLKLQEVRAE-------DGGKYACVASN----- 757

  Fly   607 TETRSTVVESGQSSEIREEIVVTEESSLEGKQVVALEREPS---PCS-----IPKIQVYRPVECE 663
                    .:|.:|:|.:..|.|....::....|.:|...|   |||     .|::..:|  :.|
 Frog   758 --------NAGTASDIIQVDVGTPPQFIDFPLDVEVEVGDSASLPCSAEGNPTPQVSWFR--QDE 812

  Fly   664 NPVVTKHKPIELKDIVGYSESLRDGDTAPAGGSPGRQQGYSANITDHASLTIWNNR--LANIAGD 726
            .|||..          |.:|.:....:........|.:..:..:.:..:...|...  |.::.| 
 Frog   813 GPVVPS----------GTTEIIEGPGSNTVHFKVARPEDAAVYVCEARNAFGWVQAEILLSVTG- 866

  Fly   727 RSGANQHLQQSGPPPPPIPPNFTRMPGFFQPLPLIAYETTIEILIVKARP-PSPPPPPPPTIKRV 790
                     .:.|.........|.:.|         :..|:...:|...| |         ::|.
 Frog   867 ---------LAAPKLAVASSEVTVLEG---------HSVTLPCTVVSGNPLP---------VQRW 904

  Fly   791 LVHTESLEQKTQNFFEGIYDAASSDTSLRNAKQKIRSIKSTVLKSKDSTNYAQDTVQKAKARDFL 855
            ..::|:|:.:.::...|............:|.:..    ..|..:..|||::          ..|
 Frog   905 TKNSEALQVQWRHSINGEGGLLIEPVQREDAGKYF----CEVTNAAGSTNHS----------ILL 955

  Fly   856 HIFTPPVKKRPIYEIVEEPVNIFELEGDYTESIADDFREPSADFEARGQSVGGMDDYYSGYSRAS 920
            |:...||       |:..|......||          |......:.:|                 
 Frog   956 HVHVAPV-------ILSGPAEYVVREG----------RAVIMSCDVKG----------------- 986

  Fly   921 TRRYETKTRDYDRGTSYDSTVERSQYGISSRRDRSSVDKVEARSSLLATGRTESRAASRAESRAE 985
               |...|..:.:| ..:.|.|.:.|.::  :|.|.:..       |.||..    ......:|.
 Frog   987 ---YPPPTVTWSKG-DLELTQENTHYYLN--KDGSIMIS-------LPTGAD----GGSYTCKAV 1034

  Fly   986 SRASYSVAESRAGIRSSSRLQEDRPLRSVDKPVVVKMLKSVQVEPGETAHFEIQFKDQPGLVTWL 1050
            :.|..|:.:.|..:.:..|:..:   .|.|:...|:::.::..|  .|...:::....| :|:|.
 Frog  1035 NPAGVSIRDVRLIVHTKPRISIN---GSHDQNAPVRVVAALGTE--ITLPCDVEGSPLP-VVSWR 1093

  Fly  1051 KDNKPLEDRLADRITQTAAPMNSYRLDIKNCSETDAGTYTIRAQSASETTTVSAQLAVGQAPGHD 1115
            ||:.||     ..::.....:.|:.|.:......|:|.|:..|.:.:..|:::..|.|...|   
 Frog  1094 KDSLPL-----PIVSARHHLLPSWSLRLSELRVMDSGYYSCLASNPAGNTSLTYSLEVQVPP--- 1150

  Fly  1116 ETKTNTEPAFLVSLKDAEMIENTLFRFM---VKIIGDPKPRVKFYKDEKEILETNDRIQIIRDKD 1177
                ...|.       |::::..|.|.:   ....|||.||:.:|||.:.:.        :.|:|
 Frog  1151 ----RVHPG-------AKVLKALLGRTLQLPCLAYGDPMPRLSWYKDGEPMR--------VGDQD 1196

  Fly  1178 YL----GFYELVIADVQKTDAGTYSCKATNKHGEANCE-----AIATTVEDKNPF----GALSGQ 1229
            .|    |  .:.:.:||.:|:|.|.|.||:..||.:.|     ..|.|.||.:..    .|....
 Frog  1197 SLQGPDG--SISVLEVQLSDSGNYRCVATSSAGEDSLEFRLEVLEAPTFEDGSDVLLEQTAYEPV 1259

  Fly  1230 ILPAGEK----PVFQWKRNGEEFDPEERFKVLFGE-----DEDSLALVFQHVKPEDAGIYTCVAQ 1285
            ||....:    |:.:|.:||         .||.|.     ...:.:|:.:...|...|.|.|||.
 Frog  1260 ILTCPVQGTPTPLIRWMKNG---------VVLVGNLPGMTQLGNGSLLIESPVPNHGGDYICVAT 1315

  Fly  1286 TSTGNISCSAELSVQGAIQTLNREPEKPTLVIEHREANASIGGSAILELQCK--GFPKPAVQWKH 1348
            ...|:.....:|.|..          ||.:..:.:..|.|:..:..|.|:|:  |.|.|.|.|..
 Frog  1316 NEAGSARRKTKLVVYA----------KPKIFEDGQGKNISVMANQPLTLRCEVSGVPFPTVTWSK 1370

  Fly  1349 DGEVIQVDDRHKFMYEDEESMSLV-------IKNVDTVDAGVYTIEAINELGQDESSINLVVKAP 1406
            ||:.:          .:...:||:       ...:...|.|.||.:|:|..|:.:.:.||::..|
 Frog  1371 DGKAL----------TEAPGLSLLAAGQSVRFHRIRKDDTGSYTCKAVNRAGEAQRTFNLMILVP 1425

  Fly  1407 PKI---KKITDITCSAGETIKMEIEVEGFPQPTVQVTNNGKDV-TAESNVKISSSSIGKSLEKVV 1467
            |.|   ..:.|:|...|..:::..:..|.|:|.|:.|.:|:.: ..:::::::...       .|
 Frog  1426 PSIYGAGSLQDMTARDGSEVELHCKASGVPRPQVEWTKDGQPLPPGDAHIQLTEGG-------QV 1483

  Fly  1468 VEVKEIKLSQAGNYSIKATNDLSQTSEYWSCTVKSKPVIVKNFE----SEYIHGEKENVQMTVRI 1528
            :::...:||..|.|...|.|...|..:.::..|.:.|.|..:.|    :..:||   .|::....
 Frog  1484 LQLNGTRLSDQGRYQCLAFNHAGQQVKDFNLRVHTPPTIWASNETTEVASLLHG---TVELRCEA 1545

  Fly  1529 DAYPEAKLTWYHDETEIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQL 1593
            .|.|...:||:.|:..| ::.|:.|....|.  :|:::.....|.|.||.:|||..|:|..|.:|
 Frog  1546 RASPVPGITWFKDKRPI-VSSSRATYREGGR--SLQLSRVLLSDVGTYTCRATNNAGTAEKSYRL 1607

  Fly  1594 LIKCAPEFT---HKLKNITVAEGDSNVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGND 1655
            .:..:|:..   .|...|....|.: :||......:|.|...|..||:.:.|:  |...:::|..
 Frog  1608 EVYVSPDIEGGGSKPLPIKAILGQA-LELECSATGHPPPTLSWLKDGLMLSER--DGLQIKDGGR 1669

  Fly  1656 FKLIMNQVATNMQGNYTCKIMNDYGKLEDNCVVTVNCKPKVKRG--------------------- 1699
             .|.:..|:...||.:||..::..|:...:..|||...|||..|                     
 Frog  1670 -TLYIGIVSEGTQGTFTCVAISLAGENVLHYTVTVLVPPKVVIGEGSEHVTVTANDPLDLSCHAT 1733

  Fly  1700 ---------LKN------------------------------------------------VEVQE 1707
                     |:|                                                |||||
 Frog  1734 GYPTPTIQWLRNNHSLSHEDGVEVLNGGKMLTIRQIQPEHAGKYKCKAEGDSGTAEAWVEVEVQE 1798

  Fly  1708 GKSFT----------------LEVEVYSEPEAKIKWFKDGHEIYEDARIKISRDTQRIENYYLTL 1756
            ..|.|                ||.:|...|...:.|:|||..:             .::...|.:
 Frog  1799 LPSVTIAGGTTMVVNFLKRVVLECDVSGSPPPSVTWWKDGFLL-------------PVQGPKLQI 1850

  Fly  1757 NLARTEDAGTYEMKATNFIGETTSTCKVAVLTS---EALSLEQTVTKTLIATTE-----EP---- 1809
            :....:|.|.|...||||.||......:.||.|   |...:.|||.:.|.|:.|     .|    
 Frog  1851 DSVSIDDEGVYTCVATNFAGEGRQDVVLTVLVSPNIEPSDVNQTVIENLPASFECLASGSPLPLV 1915

  Fly  1810 ------------------EEGAVPEIVHVDVFQQHSYE--------SVPLKYEVI---------- 1838
                              .||...:|..........|.        |..|:|.::          
 Frog  1916 SWYRGEQLLSAAPGITLLNEGKTLQIESAKSSDSGEYRCVASNTAGSTELQYNLLVNVAPRIVSM 1980

  Fly  1839 -----------------ATGIPKPEAIWYHDGKPITPDKHTAIT---VDGDHYKLEVQSLDLVDA 1883
                             |||:|:|..:|..|..|::    |||.   :......|.:::..:.|:
 Frog  1981 MDFATFLVNEQVWLECNATGVPEPAIMWLKDQVPVS----TAIAGLQIMEQGRILSLRAAHVSDS 2041

  Fly  1884 GEYKVVVQNKVGEKSH------------QGELSLSGIAEYRKPILTQGPGLKDIKVNKGDKVCEP 1936
            |.|..|..|..||.||            .||...|.|| ..:|:|.:               |:.
 Frog  2042 GIYSCVAVNPAGEDSHHIALQVFVPPTIMGEELNSSIA-VNQPLLLE---------------CQS 2090

  Fly  1937 VVFTADPAPEIVLLKDGQPVVETNNVK-------LKVDK---KDA-------------------- 1971
               ||.|.|.|..||||:|:::...|:       |::|:   :||                    
 Frog  2091 ---TAIPPPLITWLKDGRPLLQRPGVQVIDDGHYLQIDQAQLRDAGRYTCEASNDAGRTEKHYNV 2152

  Fly  1972 -------------------ENGLVQYTC--------------------------------TLNIL 1985
                               |...|.:||                                .|.|.
 Frog  2153 IIWVPPSFPEPSAPHHSIIEGQPVSFTCECTGVPPPTLTWTKNGLPLTVEDSGLVSAGGRLLQIG 2217

  Fly  1986 EAEIKDSGRYELKVKNKYGELVTSGWIDVLAKPEISGLNDT-KCL---PGDTICFEALVQANPKP 2046
            :.::.|.|.|..:..|:.|......|::|.|:|.|:|.::| |.|   .|..:..|.:|...|.|
 Frog  2218 KVQLSDEGSYICECSNQAGSNKKEYWLEVYAQPMIAGSSNTPKQLMVNKGSLVTMECVVSGKPSP 2282

  Fly  2047 KVSWTRGNENLCNHENCEVIADVDADKYRLVFQS---------VSPCEDGKYTITATNSEGRAAV 2102
            .|:|.:....|.|..:             |.||:         ..|...|:|...|.|:.|:..:
 Frog  2283 SVTWLKDGYPLGNGPD-------------LFFQNKGQQLTILKAQPSHSGRYVCVAVNAAGQTDI 2334

  Fly  2103 DFNLAVLVEKPTFIVQPE----SQSIHDYRPVSTKVLVHGVPLPTIEWFKDDKPINYEAINKPGK 2163
            .:.:.|.|.......|.|    |.|:|....::.:..  |:|.|.|.||:     |.||::.  :
 Frog  2335 KYEVFVQVPPELPNTQTELLNVSTSLHGTFTITCEAT--GIPPPVITWFR-----NNEALSP--R 2390

  Fly  2164 DKLYAKEDTKKGTDQIESVLDIKSFRENDVGAYTCVATNEIGVTKAPFKLAMLSLAPSFVKKLDN 2228
            :.::.:...:        ||.|...:..|.|.||||.||..|..|..|.:.:| :.||...:.||
 Frog  2391 ENVHLQSGGR--------VLRITHAQIQDAGHYTCVVTNTAGQAKKDFFVDIL-VPPSIDGEDDN 2446

  Fly  2229 ALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPNDSGAYK 2293
            .|.|.:|:.:.|.|.|.|.|.|.:.||:|...|:..:.:.||  ||| .:|.|.|....:.|.|.
 Frog  2447 DLRVPEGQSVTLSCKVSGHPKPLITWLRDSQPVQSGDEVLIS--PDG-SELHIQSANVFNVGHYT 2508

  Fly  2294 LIISNPHGEKVALCAVAVKPEEMQPKFLKPITSQT-----VVVGEPLKLEAQVTGFPAPEVKWYK 2353
            .|..|...|:.....|.|.   :.|....|:..:.     |:|..|..|..:..|||.|.|.|.|
 Frog  2509 CIAINSIAERSRSYIVTVL---VSPTISGPLDDEANEDVIVIVNNPFSLICEALGFPIPSVTWLK 2570

  Fly  2354 DGMLLRPSPEINFINSPNGQIGLIIDAAQPLDAGVYKCLIANKGGEIEGVSKVEI----VPKESK 2414
            :|...:.|..:..:  |.|. ||.|..||..|:|.|.|::.|:.||.....:|::    |.|...
 Frog  2571 NGEPFKDSDNLRLL--PGGH-GLQILNAQEEDSGQYTCVVTNEVGEAIRNYEVKVFIPPVIKRDD 2632

  Fly  2415 PVFVAELQDASSIEGFPVKMDIKVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKT 2479
            |.....:::..:.....:.:..:....|||.|.|:.:|..::....    |:...:...|.::..
 Frog  2633 PHQDVGIKEVKTKVNSSLTLQCESQAVPKPTLHWYKDGQLLESSGG----VQILSDGQELQLQPI 2693

  Fly  2480 APGDSGLYEVIAQNPEGSTASKAKLYV---------APKADETATEEAPQFVSALRDVNAD---E 2532
            ...|||.|..:|.|..|.  .:.:.||         .|.:...|.|..|      ||.:.:   |
 Frog  2694 RLSDSGRYTCVATNVAGE--DEKEFYVNVQVPPIFHRPGSPSAAFELVP------RDDDEEELTE 2750

  Fly  2533 GQELVLSAPFI------SNPMPEVIWSKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNYTC 2591
            .:|:|.:.|..      :.|.|.:.|.|||..|:.::.:|:..:|:.  |.|..|.|..:|.|||
 Frog  2751 HREVVATNPISLYCDTNAIPPPILTWYKDGQLLSSSDGVLILLEGRI--LQIPMAHAKHAGKYTC 2813

  Fly  2592 LLANPLGEDSSACNANVRKVYK-----PPVFTQKISDQQQ----VFGNNAKIPVTVSGVPYPDLE 2647
            ...|..|||        |..|:     |||...::.:..|    ::...|::....||:|.|.:.
 Frog  2814 EATNEAGED--------RLHYELVVLTPPVMKGEVDELIQEVSVIYNQTAELHCDASGIPPPSIT 2870

  Fly  2648 WYFQDKPIPKSEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREG------------------ 2694
            |......:..:|:|.|.|:|  ..|.:::.:..|...|.|:|.|..|                  
 Frog  2871 WLRNGLTLSTAERYQILNEG--KTLQIHSVQVSDIDSYVCVAENPAGFAERLFTLMVHVTPVISG 2933

  Fly  2695 ------KDITQGRLDIVNEIKKHSRSEPPVFLKKIGDCDIYEGMVAKFTACATGYPEPEVEWFKN 2753
                  ..:.|..:.:|.:::.|                                |.||:.|:|:
 Frog  2934 PNPENISAVLQSSVSLVCDVQSH--------------------------------PTPEIMWYKD 2966

  Fly  2754 DQKLFPSDRFLIDIEPNGLLRLTIKNVTEYDVGRYSCRIFNPYG--DDICHAELFYDSLDSQQKP 2816
            .|.|.|:...|  |.|.|.: |.|..|...:.|.|.|::.||.|  :.:.|..::          
 Frog  2967 GQLLTPTKGLL--IMPGGQV-LQIARVQMSNQGIYMCKVHNPAGSAEKLLHLIVY---------- 3018

  Fly  2817 LEDQYTDFKKYKKSGAPPPLSEGP-----IISRMTDRGLLLSWNPSVPLTPRYPITYQIEMMDLP 2876
                           .||.:.|.|     .:.|:.|                 .:|.|.|...||
 Frog  3019 ---------------VPPSIKEPPNGKQETVVRLGD-----------------SLTLQCESDALP 3051

  Fly  2877 EG--DW-----RTLRTGVRSCACDIRNLEPFRDYRFRVRVENKFGVSDPSPYTQTYRQKLVPDPP 2934
            ..  .|     :.|..||      :|    ..|:..|:.:.: ...||...||... ..:..:..
 Frog  3052 RPTITWYKNGHQLLENGV------VR----IHDHGQRLEILD-IKASDKGQYTCKV-ANMAGEVE 3104

  Fly  2935 KTYTYL--PPGTDFRPETSPYFPKDFDIERPPHDGLAQAPQFLLREQDISYGVKDHNTELMWFVY 2997
            .|||.:  .|.|..||:.                   :..|.::          .::..|.....
 Frog  3105 LTYTVIINVPATIVRPQN-------------------ETIQLII----------GNSIVLSCEAE 3140

  Fly  2998 GYPKPKMTYYFDDMLIESG-------GRFDQSYTRNGQATLFINKMLDRDVGWYEAVATNEHGEA 3055
            |.|.|.:|:..|...::||       |           :.|.|.::.....|.|..:|.|...|.
 Frog  3141 GSPSPVVTWLKDGEPLDSGVWGVAIRG-----------SRLQITRVQQSHAGRYRCIAQNSISET 3194

  Fly  3056 RQRVRLEIAEHPRFL--KRPDETFIMARKNGRIEAKLVGIPLPEVHWFKDWKP----IVDSSRIK 3114
            .:...|.:...||..  :.|.|..:..::..::|.|..|.|.|::.||||..|    :|.::|: 
 Frog  3195 HKDFVLLVQVAPRIFGSEMPSEHSVPEKQEVKLECKTEGTPAPQILWFKDGNPLDVTLVPNTRV- 3258

  Fly  3115 ISSYDPDIYVL-SIHDSIIKDGGLYSISARNIAGSISTSVTVHIEENEDQYIYKTYGRHPYVRSK 3178
              ..|.:..|| |:..|   |.|.|:..|||.||             ||..:|......|.:   
 Frog  3259 --FQDGNFLVLRSVQAS---DSGRYTCVARNNAG-------------EDTRVYVLNILVPPI--- 3302

  Fly  3179 QLRYQDKYDIGDELGR---GTQGITYHAVERSSGDNYAAKIMY---GRPELRPFMLNELEMMNTF 3237
               ::...:..|.|..   |...:..||    || :...|:.:   |.|                
 Frog  3303 ---FESGSNASDVLSSVPGGQVTLECHA----SG-SLPLKLSWFKDGHP---------------- 3343

  Fly  3238 NHKNLIRPYDAYDTDRSVTLIMELAAGGELVRDNLLR---RDYYT----------ERDIAHYIRQ 3289
                       ..|.|.|    .:|:||.::|.:.::   ...||          |::...:|..
 Frog  3344 -----------LSTSRYV----RIASGGRILRFSQVQVSDAGTYTCVASSPAGAAEKNFVLHIES 3393

  Fly  3290 --TLWGLEHMHEMGV-----------GHMGLTIKDLLISVVGGDIIKVSDF---GLSRKINRHNL 3338
              .|...|...|:..           .| |..:..|.....|..:...|:.   ||..:::..::
 Frog  3394 LPVLERSESTEEVTAIKGASVTFTCEAH-GTPLPSLSWEKDGQPLNLQSNLLPNGLGTRLHLESV 3457

  Fly  3339 STLDYGMPEFVSPEVVNKEGVNFSHDMWTV---------GLITYVLLGGHNPFLGIDDRETLTKI 3394
            ..||.|:...::   ||..|....|...||         .|.|.|.:...:| |.:....|....
 Frog  3458 RALDSGIYSCIA---VNAAGRVSKHFHLTVLEPPRIEGPALPTEVSIIADSP-LELACTATGVPT 3518

  Fly  3395 REGRWDFKDEIWTHISDDGRDFISRLLLYSPEERMDVKTALKHPWFFMLDRPVYDHDYQIGTDRL 3459
            .|..|:          .|||                   .|.||.....:..|.         |:
 Frog  3519 PEISWE----------KDGR-------------------PLSHPDLLTRNGTVL---------RI 3545

  Fly  3460 RNYYDHFRDWYANASCKNYFRRRRLSGCFQHPSKMVYPPGHVYTPENTPEPL------------- 3511
            ..........|...:.....|..|.:..     :|..||..|.:.|  |..|             
 Frog  3546 ERVKAEDAGIYVCVATSTAGRDSRATWV-----RMKVPPSVVGSTE--PRSLAVSVGGQLVLECK 3603

  Fly  3512 ----PEPRIRAKREEVVSKYLHPDYELGLIQSESHYQYGPDTYLLQLRDVNFPVRLREYMKVAHR 3572
                |.|.|:..|.::.   |..|   |.:|..|..:|      :|:..:. |....||..:|  
 Frog  3604 VEADPPPTIQWYRGDIP---LQTD---GRVQVLSKGRY------VQIHSLR-PSDSGEYTCIA-- 3653

  Fly  3573 RSPSFALNDSVDWSLPVIRERRRFTDIMDEEIDDERTRSRISMYAANESYSIRRLRTELGPRLDE 3637
                         |.|..|....||                                        
 Frog  3654 -------------SNPAGRTSLHFT---------------------------------------- 3665

  Fly  3638 YTEADAMIETQREGYPPFFREKPQTIAITENQPSHIHCFAVGDPKPCVQWFKNDMVLT-ESKRIK 3701
                   :|.|   ..|..:..|..::::.||.:.:.|...|.|.|...|.|:...|: |..|::
 Frog  3666 -------VEIQ---LAPMIQPGPSVVSVSVNQTAVLPCRMEGIPLPVASWRKDGSPLSVEISRME 3720

  Fly  3702 ISVDEDGRSILRFEPALHFDVGVYKVVARNKVG 3734
            ...|    ..||...||..|.|.|.....|..|
 Frog  3721 FLAD----GSLRIPQALLQDSGYYLCTVTNSAG 3749

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Unc-89NP_001097440.1 RhoGEF 90..260 CDD:238091 12/43 (28%)
PH_unc89 275..388 CDD:270134 21/154 (14%)
Atrophin-1 <493..690 CDD:331285 40/204 (20%)
TonB_N 502..>596 CDD:318287 15/93 (16%)
I-set 1017..1108 CDD:333254 18/90 (20%)
I-set 1123..1212 CDD:254352 27/100 (27%)
I-set <1236..1299 CDD:333254 16/71 (23%)
I-set 1313..1403 CDD:254352 24/98 (24%)
Ig_3 1406..1487 CDD:316449 18/84 (21%)
I-set 1499..1595 CDD:254352 28/99 (28%)
I-set 1599..1690 CDD:333254 22/93 (24%)
I-set 1694..1786 CDD:254352 31/185 (17%)
I-set <1836..1903 CDD:333254 22/108 (20%)
I-set 1922..2005 CDD:333254 26/163 (16%)
I-set 2018..2108 CDD:333254 24/102 (24%)
I-set 2113..2214 CDD:333254 28/104 (27%)
I-set 2220..2302 CDD:254352 29/81 (36%)
I-set 2318..2408 CDD:254352 30/94 (32%)
I-set 2415..2506 CDD:254352 16/90 (18%)
I-set 2519..2608 CDD:254352 28/97 (29%)
I-set 2615..2696 CDD:254352 21/108 (19%)
I-set 2717..2805 CDD:254352 22/89 (25%)
FN3 2834..2925 CDD:238020 21/102 (21%)
I-set <2996..3063 CDD:333254 16/73 (22%)
I-set 3067..3157 CDD:333254 29/96 (30%)
PK_Unc-89_rpt1 3182..3440 CDD:271011 54/301 (18%)
I-set 3654..3744 CDD:333254 23/82 (28%)
FN3 3748..3840 CDD:238020
STKc_Unc-89_rpt2 3893..4151 CDD:271014
hmcn2XP_031747766.1 vWFA 29..165 CDD:238119
IG_like 434..503 CDD:214653 18/93 (19%)
Ig strand B 434..438 CDD:409353 2/3 (67%)
Ig strand C 447..451 CDD:409353 0/3 (0%)
Ig strand E 469..473 CDD:409353 1/12 (8%)
Ig strand F 483..488 CDD:409353 1/4 (25%)
Ig 514..592 CDD:416386 11/88 (13%)
Ig strand A' 515..518 CDD:409353 2/2 (100%)
Ig strand B 524..531 CDD:409353 1/6 (17%)
Ig strand C 537..542 CDD:409353 0/4 (0%)
Ig strand C' 544..546 CDD:409353 0/1 (0%)
Ig strand D 551..555 CDD:409353 0/3 (0%)
Ig strand E 558..563 CDD:409353 0/4 (0%)
Ig strand F 571..579 CDD:409353 0/7 (0%)
Ig strand G 582..592 CDD:409353 2/20 (10%)
I-set 596..681 CDD:400151 19/97 (20%)
Ig strand B 613..617 CDD:409353 1/3 (33%)
Ig strand C 626..630 CDD:409353 1/3 (33%)
Ig strand E 648..652 CDD:409353 0/3 (0%)
Ig strand F 662..667 CDD:409353 1/5 (20%)
Ig strand G 676..679 CDD:409353 0/2 (0%)
Ig 695..770 CDD:416386 23/129 (18%)
Ig strand B 703..707 CDD:409353 0/3 (0%)
Ig strand C 716..720 CDD:409353 1/3 (33%)
Ig strand E 736..740 CDD:409353 0/3 (0%)
Ig strand F 750..755 CDD:409353 1/4 (25%)
Ig strand G 763..766 CDD:409353 1/2 (50%)
Ig strand A 774..778 CDD:409353 0/3 (0%)
IG_like 780..864 CDD:214653 17/95 (18%)
Ig strand A' 781..786 CDD:409353 1/4 (25%)
Ig strand B 790..798 CDD:409353 4/7 (57%)
Ig strand C 804..809 CDD:409353 0/4 (0%)
Ig strand C' 812..815 CDD:409353 1/2 (50%)
Ig strand D 822..825 CDD:409353 1/2 (50%)
Ig strand F 843..851 CDD:409353 0/7 (0%)
I-set 870..957 CDD:400151 17/118 (14%)
Ig strand A' 878..881 CDD:409353 0/2 (0%)
Ig strand B 887..895 CDD:409353 1/7 (14%)
Ig strand C 901..906 CDD:409353 1/4 (25%)
Ig strand C' 909..911 CDD:409353 1/1 (100%)
Ig strand D 917..921 CDD:409353 0/3 (0%)
Ig strand E 923..927 CDD:409353 0/3 (0%)
Ig strand F 936..944 CDD:409353 1/11 (9%)
Ig strand G 947..957 CDD:409353 4/19 (21%)
I-set 961..1048 CDD:400151 23/137 (17%)
Ig strand A' 969..973 CDD:409353 0/3 (0%)
Ig strand B 977..984 CDD:409353 0/6 (0%)
Ig strand C 991..996 CDD:409353 1/4 (25%)
Ig strand C' 998..1001 CDD:409353 0/2 (0%)
Ig strand D 1007..1011 CDD:409353 1/3 (33%)
Ig strand E 1014..1020 CDD:409353 1/12 (8%)
Ig strand F 1027..1035 CDD:409353 1/7 (14%)
Ig strand G 1038..1048 CDD:409353 2/9 (22%)
Ig 1065..1146 CDD:416386 18/88 (20%)
Ig strand A' 1067..1070 CDD:409353 0/2 (0%)
Ig strand B 1076..1083 CDD:409353 1/6 (17%)
Ig strand C 1089..1094 CDD:409353 2/4 (50%)
Ig strand C' 1096..1098 CDD:409353 0/1 (0%)
Ig strand D 1105..1109 CDD:409353 0/3 (0%)
Ig strand E 1112..1117 CDD:409353 1/4 (25%)
Ig strand F 1125..1133 CDD:409353 3/7 (43%)
Ig strand G 1136..1146 CDD:409353 2/9 (22%)
Ig 1157..1237 CDD:416386 25/89 (28%)
Ig strand B 1167..1174 CDD:409353 0/6 (0%)
Ig strand C 1180..1185 CDD:409353 1/4 (25%)
Ig strand C' 1187..1189 CDD:409353 0/1 (0%)
Ig strand D 1196..1200 CDD:409353 2/3 (67%)
Ig strand E 1203..1208 CDD:409353 1/6 (17%)
Ig strand F 1216..1224 CDD:409353 4/7 (57%)
Ig strand G 1227..1237 CDD:409353 3/9 (33%)
Ig 1241..1329 CDD:416386 22/96 (23%)
Ig strand A 1241..1244 CDD:409353 1/2 (50%)
Ig strand A' 1250..1253 CDD:409353 0/2 (0%)
Ig strand B 1259..1266 CDD:409353 2/6 (33%)
Ig strand C 1272..1277 CDD:409353 1/4 (25%)
Ig strand C' 1280..1282 CDD:409353 0/1 (0%)
Ig strand D 1289..1293 CDD:409353 0/3 (0%)
Ig strand E 1295..1299 CDD:409353 1/3 (33%)
Ig strand F 1308..1316 CDD:409353 5/7 (71%)
Ig strand G 1319..1329 CDD:409353 2/9 (22%)
I-set 1342..1420 CDD:400151 21/87 (24%)
Ig strand A' 1343..1346 CDD:409353 1/2 (50%)
Ig strand B 1352..1359 CDD:409353 3/6 (50%)
Ig strand C 1365..1370 CDD:409353 2/4 (50%)
Ig strand C' 1373..1375 CDD:409353 0/1 (0%)
Ig strand D 1381..1385 CDD:409353 2/3 (67%)
Ig strand E 1387..1392 CDD:409353 0/4 (0%)
Ig strand F 1401..1409 CDD:409353 4/7 (57%)
Ig strand G 1412..1420 CDD:409353 1/7 (14%)
I-set 1434..1516 CDD:400151 17/88 (19%)
Ig strand A' 1436..1439 CDD:409353 1/2 (50%)
Ig strand B 1445..1452 CDD:409353 0/6 (0%)
Ig strand C 1458..1463 CDD:409353 1/4 (25%)
Ig strand C' 1465..1467 CDD:409353 1/1 (100%)
Ig strand D 1474..1478 CDD:409353 0/3 (0%)
Ig strand E 1481..1487 CDD:409353 1/12 (8%)
Ig strand F 1495..1503 CDD:409353 3/7 (43%)
I-set 1538..1609 CDD:400151 22/73 (30%)
Ig strand B 1539..1546 CDD:409353 1/6 (17%)
Ig strand C 1552..1557 CDD:409353 2/4 (50%)
Ig strand C' 1559..1561 CDD:409353 0/1 (0%)
Ig strand D 1567..1571 CDD:409353 1/3 (33%)
Ig strand E 1574..1580 CDD:409353 2/7 (29%)
Ig strand F 1588..1596 CDD:409353 4/7 (57%)
Ig strand G 1599..1609 CDD:409353 4/9 (44%)
Ig 1621..1703 CDD:416386 21/85 (25%)
Ig strand A' 1624..1628 CDD:409353 1/3 (33%)
Ig strand B 1632..1639 CDD:409353 2/7 (29%)
Ig strand C 1646..1651 CDD:409353 1/4 (25%)
Ig strand C' 1653..1656 CDD:409353 1/2 (50%)
Ig strand D 1661..1665 CDD:409353 0/3 (0%)
Ig strand E 1668..1675 CDD:409353 1/7 (14%)
Ig strand F 1682..1690 CDD:409353 3/7 (43%)
I-set 1717..1796 CDD:400151 3/78 (4%)
Ig strand C 1739..1743 CDD:409353 0/3 (0%)
Ig strand E 1762..1766 CDD:409353 0/3 (0%)
Ig strand F 1776..1781 CDD:409353 0/4 (0%)
Ig 1796..1880 CDD:416386 23/96 (24%)
Ig strand A' 1801..1804 CDD:409353 1/2 (50%)
Ig strand B 1818..1825 CDD:409353 2/6 (33%)
Ig strand C 1831..1836 CDD:409353 1/4 (25%)
Ig strand C' 1838..1840 CDD:409353 1/1 (100%)
Ig strand F 1859..1867 CDD:409353 3/7 (43%)
Ig strand G 1870..1880 CDD:409353 2/9 (22%)
I-set 1886..1964 CDD:400151 13/77 (17%)
Ig strand A' 1892..1895 CDD:409353 1/2 (50%)
Ig strand B 1901..1908 CDD:409353 2/6 (33%)
Ig strand C 1914..1919 CDD:409353 0/4 (0%)
Ig strand C' 1920..1922 CDD:409353 0/1 (0%)
Ig strand D 1929..1933 CDD:409353 0/3 (0%)
Ig strand E 1936..1942 CDD:409353 1/5 (20%)
Ig strand F 1950..1958 CDD:409353 1/7 (14%)
Ig 1984..2063 CDD:416386 21/82 (26%)
Ig strand B 1992..1999 CDD:409353 0/6 (0%)
Ig strand C 2005..2010 CDD:409353 1/4 (25%)
Ig strand C' 2012..2014 CDD:409353 0/1 (0%)
Ig strand D 2022..2025 CDD:409353 0/2 (0%)
Ig strand E 2029..2035 CDD:409353 1/5 (20%)
Ig strand F 2042..2049 CDD:409353 3/6 (50%)
Ig strand G 2055..2063 CDD:409353 2/7 (29%)
Ig_3 2066..2141 CDD:404760 23/93 (25%)
Ig strand B 2084..2088 CDD:409353 1/18 (6%)
Ig strand C 2097..2101 CDD:409353 1/3 (33%)
Ig strand E 2120..2124 CDD:409353 1/3 (33%)
Ig strand F 2134..2139 CDD:409353 0/4 (0%)
Ig strand A 2158..2161 CDD:409353 0/2 (0%)
Ig strand A' 2167..2170 CDD:409353 0/2 (0%)
Ig 2170..2246 CDD:416386 12/75 (16%)
Ig strand B 2176..2183 CDD:409353 3/6 (50%)
Ig strand C 2189..2194 CDD:409353 0/4 (0%)
Ig strand C' 2197..2199 CDD:409353 0/1 (0%)
Ig strand E 2204..2216 CDD:409353 1/11 (9%)
Ig strand F 2225..2233 CDD:409353 2/7 (29%)
Ig strand G 2236..2246 CDD:409353 2/9 (22%)
I-set 2259..2340 CDD:400151 20/93 (22%)
Ig strand B 2270..2274 CDD:409353 0/3 (0%)
Ig strand C 2283..2287 CDD:409353 1/3 (33%)
Ig strand E 2306..2310 CDD:409353 0/3 (0%)
Ig strand F 2320..2325 CDD:409353 1/4 (25%)
Ig_3 2343..2421 CDD:404760 23/94 (24%)
Ig strand B 2364..2368 CDD:409353 0/3 (0%)
Ig strand C 2377..2381 CDD:409353 1/3 (33%)
Ig strand E 2400..2404 CDD:409353 2/11 (18%)
Ig strand F 2414..2419 CDD:409353 3/4 (75%)
Ig strand A 2437..2440 CDD:409353 1/2 (50%)
I-set 2447..2526 CDD:400151 27/81 (33%)
Ig strand A' 2447..2450 CDD:409353 1/2 (50%)
Ig strand B 2455..2463 CDD:409353 2/7 (29%)
Ig strand C 2469..2473 CDD:409353 0/3 (0%)
Ig strand C' 2476..2479 CDD:409353 0/2 (0%)
Ig strand D 2484..2488 CDD:409353 0/3 (0%)
Ig strand E 2492..2497 CDD:409353 1/4 (25%)
Ig strand F 2505..2513 CDD:409353 3/7 (43%)
Ig strand G 2516..2526 CDD:409353 2/9 (22%)
I-set 2530..2622 CDD:400151 30/94 (32%)
Ig strand B 2552..2556 CDD:409353 1/3 (33%)
Ig strand C 2565..2569 CDD:409353 1/3 (33%)
Ig strand E 2588..2592 CDD:409353 2/4 (50%)
Ig strand F 2602..2607 CDD:409353 2/4 (50%)
I-set 2633..2720 CDD:400151 18/92 (20%)
Ig strand B 2650..2654 CDD:409353 0/3 (0%)
Ig strand C 2663..2667 CDD:409353 1/3 (33%)
Ig strand E 2686..2690 CDD:409353 1/3 (33%)
Ig strand F 2700..2705 CDD:409353 1/4 (25%)
Ig 2760..2830 CDD:416386 23/79 (29%)
Ig strand B 2760..2764 CDD:409353 0/3 (0%)
Ig strand C 2773..2777 CDD:409353 0/3 (0%)
Ig strand E 2797..2800 CDD:409353 1/4 (25%)
Ig strand F 2810..2815 CDD:409353 3/4 (75%)
I-set 2839..2925 CDD:400151 19/87 (22%)
Ig strand A' 2845..2850 CDD:409353 1/4 (25%)
Ig strand B 2855..2863 CDD:409353 1/7 (14%)
Ig strand C 2867..2873 CDD:409353 2/5 (40%)
Ig strand C' 2875..2877 CDD:409353 0/1 (0%)
Ig strand D 2883..2889 CDD:409353 2/5 (40%)
Ig strand E 2890..2896 CDD:409353 2/7 (29%)
Ig strand F 2905..2912 CDD:409353 3/6 (50%)
Ig strand G 2915..2923 CDD:409353 1/7 (14%)
I-set 2929..3017 CDD:400151 25/122 (20%)
Ig strand A 2929..2932 CDD:409353 0/2 (0%)
Ig strand A' 2936..2941 CDD:409353 0/4 (0%)
Ig strand B 2947..2954 CDD:409353 1/6 (17%)
Ig strand C 2960..2965 CDD:409353 2/4 (50%)
Ig strand D 2976..2979 CDD:409353 1/4 (25%)
Ig strand E 2983..2989 CDD:409353 2/6 (33%)
Ig strand F 2996..3003 CDD:409353 3/6 (50%)
Ig strand G 3009..3017 CDD:409353 1/7 (14%)
Ig strand A 3020..3029 CDD:409353 4/8 (50%)
I-set 3034..3111 CDD:400151 21/105 (20%)
Ig strand B 3039..3049 CDD:409353 4/26 (15%)
Ig strand C 3053..3059 CDD:409353 1/5 (20%)
Ig strand C' 3061..3064 CDD:409353 0/2 (0%)
Ig strand E 3077..3083 CDD:409353 1/5 (20%)
Ig strand F 3089..3098 CDD:409353 2/9 (22%)
Ig_3 3116..3189 CDD:404760 18/112 (16%)
Ig strand A 3119..3122 CDD:409353 2/2 (100%)
Ig strand A' 3124..3128 CDD:409353 1/3 (33%)
Ig strand B 3132..3139 CDD:409353 1/6 (17%)
Ig strand C 3146..3151 CDD:409353 1/4 (25%)
Ig strand C' 3153..3156 CDD:409353 0/2 (0%)
Ig strand D 3162..3166 CDD:409353 0/3 (0%)
Ig strand E 3168..3174 CDD:409353 2/5 (40%)
Ig strand F 3181..3189 CDD:409353 3/7 (43%)
Ig_3 3206..3284 CDD:404760 25/83 (30%)
Ig strand B 3225..3229 CDD:409353 0/3 (0%)
Ig strand C 3238..3242 CDD:409353 0/3 (0%)
Ig strand E 3263..3267 CDD:409353 0/3 (0%)
Ig strand F 3277..3282 CDD:409353 1/4 (25%)
Ig strand G 3291..3294 CDD:409353 0/2 (0%)
I-set 3318..3391 CDD:400151 18/108 (17%)
Ig strand B 3321..3325 CDD:409353 0/3 (0%)
Ig strand C 3334..3338 CDD:409353 1/3 (33%)
Ig strand E 3357..3361 CDD:409353 0/3 (0%)
Ig strand F 3371..3376 CDD:409353 2/4 (50%)
Ig strand A 3395..3398 CDD:409353 0/2 (0%)
Ig strand A' 3403..3408 CDD:409353 1/4 (25%)
I-set 3406..3484 CDD:400151 14/81 (17%)
Ig strand B 3414..3421 CDD:409353 0/6 (0%)
Ig strand C 3427..3432 CDD:409353 1/4 (25%)
Ig strand D 3443..3446 CDD:409353 0/2 (0%)
Ig strand E 3450..3456 CDD:409353 0/5 (0%)
Ig strand F 3463..3470 CDD:409353 1/9 (11%)
Ig strand G 3476..3484 CDD:409353 1/7 (14%)
Ig_3 3487..3561 CDD:404760 17/112 (15%)
Ig strand A' 3498..3501 CDD:409353 1/2 (50%)
Ig strand B 3507..3514 CDD:409353 1/6 (17%)
Ig strand C 3520..3525 CDD:409353 2/14 (14%)
Ig strand C' 3527..3529 CDD:409353 2/20 (10%)
Ig strand D 3534..3538 CDD:409353 0/3 (0%)
Ig strand E 3541..3546 CDD:409353 2/13 (15%)
Ig strand F 3554..3562 CDD:409353 1/7 (14%)
I-set 3585..3668 CDD:400151 23/159 (14%)
Ig strand A' 3589..3592 CDD:409353 1/2 (50%)
Ig strand B 3598..3605 CDD:409353 0/6 (0%)
Ig strand C 3611..3616 CDD:409353 1/4 (25%)
Ig strand C' 3618..3620 CDD:409353 0/1 (0%)
Ig strand D 3626..3630 CDD:409353 1/3 (33%)
Ig strand E 3633..3639 CDD:409353 2/11 (18%)
Ig strand F 3647..3655 CDD:409353 3/22 (14%)
Ig strand G 3658..3668 CDD:409353 3/56 (5%)
I-set 3672..3759 CDD:400151 23/82 (28%)
Ig strand A 3673..3676 CDD:409353 0/2 (0%)
Ig strand A' 3680..3683 CDD:409353 0/2 (0%)
Ig strand B 3689..3696 CDD:409353 1/6 (17%)
Ig strand C 3702..3707 CDD:409353 1/4 (25%)
Ig strand C' 3709..3711 CDD:409353 0/1 (0%)
Ig strand D 3718..3722 CDD:409353 1/3 (33%)
Ig strand E 3725..3730 CDD:409353 2/4 (50%)
Ig strand F 3738..3746 CDD:409353 2/7 (29%)
TSP1 3766..3817 CDD:214559
TSP1 3822..3873 CDD:214559
nidG2 3876..4057 CDD:412205
EGF_CA 4111..4149 CDD:214542
EGF_CA 4151..4194 CDD:311536
EGF_CA 4196..4233 CDD:214542
EGF_CA 4234..4267 CDD:214542
EGF_CA 4276..4317 CDD:311536
EGF_CA 4319..4358 CDD:311536
EGF_CA 4424..4463 CDD:214542
EGF_CA 4464..4504 CDD:214542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2879
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.