DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Unc-89 and vsig10l

DIOPT Version :9

Sequence 1:NP_001097440.1 Gene:Unc-89 / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:XP_009290965.1 Gene:vsig10l / 100333975 ZFINID:ZDB-GENE-131127-231 Length:680 Species:Danio rerio


Alignment Length:666 Identity:148/666 - (22%)
Similarity:240/666 - (36%) Gaps:179/666 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  2309 VAVKPEEMQPKF--------LKPI--TSQTVVVGEPLKLEAQVTGFPAPEVKWYKDGMLLRPSPE 2363
            |.:..|.:.|.|        |.|:  .|...:||..:.|.....|...|||.|:. |.||.....
Zfish    13 VKINMEVISPMFTGHLCFLTLSPMGRVSIQALVGTNVTLAVSHAGASQPEVMWFL-GKLLVAKWT 76

  Fly  2364 INFINSPNGQIGLIIDAAQP----------LDAGVYKCLIANKGGEIEGVSKVEIVPKESKPVFV 2418
            :...:.|:...| ::.|.|.          :..|.| .:..||.||.:..:..::        |:
Zfish    77 VGESSLPDAASG-VLKAEQDGSLTFRNVSMIYNGTY-TVEMNKIGEAKVSATFDL--------FI 131

  Fly  2419 AEL--------QDASSIEGFPVKMDI---KVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSS 2472
            .:|        ....:||| .||..:   .:.|..| ::||..||.:|| |.||.:|     :..
Zfish   132 YDLIMNVSLHTDSDDAIEG-EVKFSLYYSTIQGEAK-EVQWLFNGLQIK-DGSHYSI-----SGK 188

  Fly  2473 SLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKADETATEEAPQ---FVSALRDVNADEGQ 2534
            .|.|::.:..|:|.|.|:..||..|......:.|....|....:.:|.   |||         |:
Zfish   189 RLTIKQPSRNDTGRYTVLLTNPFSSEDHHRNITVLYGPDMPLLKVSPTKAVFVS---------GE 244

  Fly  2535 ELVLSAPFISNPMPEVIWSKDGVTL---TPNERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANP 2596
            .|.||......|.|...|:.:|.::   :|..            :::...:...||.||||:.| 
Zfish   245 SLFLSCQADGEPAPSNTWTFNGESIPAFSPGT------------VSLTDVKTNQSGVYTCLMIN- 296

  Fly  2597 LGEDSSACNANVRK-----VYKPPVFTQKISDQQQVFGNNAK--IPVTVSGVP-----YPDLEWY 2649
                 |..||.:::     ||:.|....:.| .|.|.|..|.  :.|...|.|     :|.|.  
Zfish   297 -----SRTNAALQRNITVIVYESPSGAPQCS-VQTVPGGAALQFLCVWPGGAPAARVSFPSLS-- 353

  Fly  2650 FQDKPIPKSEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIVNEIKKHSR- 2713
                        ....:||:.:.:        |.::|.   ||:         :|:...:...| 
Zfish   354 ------------DAGGEGDYSITV--------QDIHKL---NRQ---------EIICTAEHPLRS 386

  Fly  2714 -------SEPPVFLKKIGDCDIYEGMVAKFTACA-TGYPEPEVEWFKNDQKLFPSDRFLIDIEPN 2770
                   |.|..||..:......:..:.....|: ...||..|.|.|:.::|....::.|.....
Zfish   387 THCSVFPSAPVDFLAVVSTSVSADDQMMVLMVCSPEATPEALVFWMKSGERLQNDHKYQISTNTT 451

  Fly  2771 GLLRLTIKNVTEYDVGRYSCRIFNPYGDDICHAELFYDSLDSQQKPLEDQYTDFKKYKKSGAPPP 2835
             .||:...|.:..|:..|:|...||.|:...|..|                          ..|.
Zfish   452 -QLRIRDFNASSADLDTYTCSAVNPLGNKTLHTTL--------------------------TGPQ 489

  Fly  2836 LSEGPIISRMTDRGLLLSWNPSVPLTPRYPIT-YQIEMM-------DLPEGDWRTLR-TGVRSCA 2891
            :|...::|......:.|:|:  ||||.  .|| :.|:|.       |:...|:.|:: ....|.:
Zfish   490 ISNSSVLSNEDGTEVTLTWD--VPLTS--VITGFDIQMKGPEFSQPDVNTADFHTIQIMPAFSRS 550

  Fly  2892 CDIRNLEPFRDYRFRV 2907
            ..|..|:|...|.||:
Zfish   551 AGISALDPKSTYYFRI 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Unc-89NP_001097440.1 RhoGEF 90..260 CDD:238091
PH_unc89 275..388 CDD:270134
Atrophin-1 <493..690 CDD:331285
TonB_N 502..>596 CDD:318287
I-set 1017..1108 CDD:333254
I-set 1123..1212 CDD:254352
I-set <1236..1299 CDD:333254
I-set 1313..1403 CDD:254352
Ig_3 1406..1487 CDD:316449
I-set 1499..1595 CDD:254352
I-set 1599..1690 CDD:333254
I-set 1694..1786 CDD:254352
I-set <1836..1903 CDD:333254
I-set 1922..2005 CDD:333254
I-set 2018..2108 CDD:333254
I-set 2113..2214 CDD:333254
I-set 2220..2302 CDD:254352
I-set 2318..2408 CDD:254352 26/109 (24%)
I-set 2415..2506 CDD:254352 28/101 (28%)
I-set 2519..2608 CDD:254352 23/94 (24%)
I-set 2615..2696 CDD:254352 17/87 (20%)
I-set 2717..2805 CDD:254352 20/88 (23%)
FN3 2834..2925 CDD:238020 23/83 (28%)
I-set <2996..3063 CDD:333254
I-set 3067..3157 CDD:333254
PK_Unc-89_rpt1 3182..3440 CDD:271011
I-set 3654..3744 CDD:333254
FN3 3748..3840 CDD:238020
STKc_Unc-89_rpt2 3893..4151 CDD:271014
vsig10lXP_009290965.1 Ig 46..131 CDD:299845 20/95 (21%)
Ig 167..223 CDD:299845 19/61 (31%)
IG_like 235..311 CDD:214653 23/102 (23%)
IGc2 242..293 CDD:197706 14/71 (20%)
Ig 413..478 CDD:299845 16/65 (25%)
FN3 496..583 CDD:238020 21/75 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4475
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.