DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Unc-89 and hmcn1

DIOPT Version :9

Sequence 1:NP_001097440.1 Gene:Unc-89 / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster
Sequence 2:XP_012816895.2 Gene:hmcn1 / 100135378 XenbaseID:XB-GENE-6258572 Length:5519 Species:Xenopus tropicalis


Alignment Length:4686 Identity:979/4686 - (20%)
Similarity:1576/4686 - (33%) Gaps:1508/4686 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PKEGWVPIDILEFNPTMSSS--------NGKESGDAEFRKLTILRE---LVETEEEFSRDLLHVV 109
            ||..|     ...|.|..||        :.:::|..:..||.:..|   :.|.|.:|.: :....
 Frog   823 PKIKW-----RRLNHTSESSKPLSYQYNSQQKAGTLQINKLWVGDEGIYICEAENQFGK-ISSQA 881

  Fly   110 EKYIKGIDKPVVPRS------VRDNKDIIFCNFLQIAEFHNNVLKEGLKCYSNQPNMVAKTFLRL 168
            ...:.|:..||:..|      :..|:..:.|..|.     .|.|.                    
 Frog   882 TITVTGLVVPVIGESPSVVSVIEGNQVTLPCVLLV-----GNPLP-------------------- 921

  Fly   169 ERDFDKHVVYCQNEPLAQDYLGSSPDAKKYFQELSKQLGDDKSLAEHLKLPIQRINDYQLLFKDF 233
            ||.:.|..|.....|..                   .:..|.||  ||:         ::|.||.
 Frog   922 ERHWVKDNVVLVTNPYT-------------------SIRADGSL--HLE---------RVLLKDG 956

  Fly   234 IKYSLSLKENVKDLERALELMLSV-PSRAYDNRFLSSIEG------CRGN-------IYKL---- 280
            ..|..:.|......:|...:.:.| |...:..:..|:|||      |:.:       |:|.    
 Frog   957 GDYLCTAKNVAGTADRITTINVHVSPVIQHGPQIFSTIEGIAVSLPCKASGVPKPTIIWKKKGEI 1021

  Fly   281 -------------GRLLLHA---------WCNVVDKEGKAHDRYCFLFKSRILVTKVRKISENRS 323
                         |.|||.:         .|:.::..|.|                .||:  ..:
 Frog  1022 VVPNNDTIIAESDGTLLLSSPGGEDSGEYSCSAINAAGYA----------------ARKV--QLT 1068

  Fly   324 VFILQNIVKLPLCNIELKADEKQIHLSLKAPEANSFLPIDIKPHGPEAHLTWFNEISSHINQDVT 388
            |::...||. |..|....|.:.||.:|::|.: :..||.::| ..|...:||             
 Frog  1069 VYVKPRIVS-PDANGSSIAQKNQIEISVRAGD-DVILPCEVK-SVPPPFITW------------- 1117

  Fly   389 LQEHNADDLKVDASQIASESELILHLPQRAEAHDPNLSVRPSDVAENYFLSKETK---------- 443
                            |.|::||....||   |    |:.||...:.:    ||:          
 Frog  1118 ----------------AKETQLISPFSQR---H----SIFPSGSLKIF----ETRVSDAGMYTCV 1155

  Fly   444 -ERLQHEQQELLKLEQEAIELY---KKQQSSKSVSSKTESVEITSSQVKSSSEVRKVVSPPPPPQ 504
             ..:.....:|:||     .:|   |.|:..|.:..|          :..|.|:..:....|||.
 Frog  1156 GTNIAGNITQLVKL-----SVYVPPKIQRGPKLIRVK----------LGHSFEIACISHGIPPPT 1205

  Fly   505 A------QVKEV-----TPVKVVSSPPPPKEITPAKVATPPPQPQVVTSPVKEVAPPPQPRAVAS 558
            |      |:.|.     ..:..|.|..|....|...||:.........:.|:..|||        
 Frog  1206 AAWYKDGQIMEFDQGQDNNMLRVESAKPSDGGTYTCVASNVIGTDSANATVEIYAPP-------- 1262

  Fly   559 PAKEVTPSQSEP--------------VKAPSPIKEVRKEVPPSASHSKEVEALVATEIRESLTET 609
                 |.|..||              :..|.|:|...|.|.....:.||   |..:|...::.|.
 Frog  1263 -----TLSDLEPPYNKQNQERISRQQISFPCPVKGHPKPVIKWFRNGKE---LTGSEPGVNIVED 1319

  Fly   610 RSTVV------------------ESGQSSE-----------IREEIVVTEESSLEGKQVVALERE 645
            |:.:|                  |:||:.:           |::..:::..|.|. .|.::|..|
 Frog  1320 RAVLVIDSLTPYDNGEYTCVASNEAGQTEKKYSLKVHDPPLIKDMDIISNVSVLL-HQTMSLLCE 1383

  Fly   646 PSPCSIPKIQVYR---------PVE-CENPVVTKHKPIELKDIVGYSESLRDGDTAPAGGSPGR- 699
            .|....|.|..|:         .|: .|...:.|...:.|||...|        |..|....|. 
 Frog  1384 ASGSPPPLITWYKGRTQVDESATVQILEKGKILKILKMALKDSGHY--------TCKANNIAGES 1440

  Fly   700 QQGYSANITDHASL----TIWNNRLANIAGDRSGANQHLQQSGPPPPPIPPNFTRMPGFFQPLPL 760
            ::.|..|:.|..::    ||  :.::.|||..  .|...:..|.|.|.|.        :|:...|
 Frog  1441 KKQYFVNVLDPPTIAGVGTI--SDVSVIAGRE--VNLECKVKGIPFPSIQ--------WFKENRL 1493

  Fly   761 IAYETTIEILIVKARPPSPPPPPPPTIKRVLVHTESLEQKTQNFFEGIYDAASSDTSLRNAKQKI 825
            ::.|....:::...:               ::|.:......    .|.|...:::|    |..:.
 Frog  1494 LSTEDPNVVMLENGQ---------------VLHIKHSRLSD----SGKYKCIAANT----AGSQT 1535

  Fly   826 RSIKSTV-----LKSKDSTNYAQDTVQ-----KAKARDFLHIFTPPVKKRPIYEIVEEPVNIFEL 880
            :.||.||     :|..:||.....||.     :..||..     ||            |..|:..
 Frog  1536 KEIKLTVYIAPTIKDGNSTTDLSFTVNGEINLECDARGI-----PP------------PTIIWYK 1583

  Fly   881 EGDYTESIADDFREPSADFEARGQSVGGMDDYYSGYSRASTRRYETKTRDYDRGTSYDSTVERSQ 945
            :|:..      ...|...:..:|:           |.|.      |:::..|.|| |..:|..  
 Frog  1584 DGEPL------LPSPYVTYIQKGK-----------YLRI------TESQITDGGT-YTCSVTN-- 1622

  Fly   946 YGISSRRDRSSVDKVEARSSLLATGRTESRAASRAESRAESRASYSVAESRAGIRSSSRLQEDRP 1010
                                  ..|:||.              :|||     .|...:|:..|..
 Frog  1623 ----------------------VAGQTEK--------------NYSV-----DIYVPARIHGDEK 1646

  Fly  1011 LRSVDKPVVVKMLKSVQVEPGETAHFEIQFKDQPGLVTWLKDNKPLEDRLADRITQTAAPMNSYR 1075
             :..:|.|:|.  ||:.:|...|.|       .|.|:|||||..|:|..  |.|   ....|..:
 Frog  1647 -KHQNKKVIVG--KSLTLECEATGH-------PPPLITWLKDGVPVETN--DNI---RLHYNGKK 1696

  Fly  1076 LDIKNCSETDAGTYTIRAQSASETTTVSAQLAVGQAPGHDETKTNTEPAFLVSLKDAEMIENTLF 1140
            |:|:|..|.|.|.||..|.:.:..|.:..:::|...|   ..:...:||      |..:|.:...
 Frog  1697 LEIRNTVEYDRGLYTCVAVNVAGETEMKYKVSVLVPP---SIEGGNDPA------DHTVIASGAV 1752

  Fly  1141 RFMVKIIGDPKPRVKFYKDEKEILETNDRIQIIRDKDYLGFYELVIADVQKTDAGTYSCKATNKH 1205
            .......|.|.|.|.:.|:...: :|:.|: ||:...    ::|:|:..:.:|:|.|.|...|:.
 Frog  1753 ELECLASGTPLPSVMWLKNGTPV-DTSGRL-IIQSNG----HKLLISSTESSDSGNYQCVVKNEA 1811

  Fly  1206 GEANCE-----AIATTVED-KNPFG-----ALSGQILPAG-EKPVFQWKRNGEEFD-PEERFKV- 1256
            |.:..:     .:..|::. .:|..     |.:.|.:.:| ..|...|.::|..|: .:...|: 
 Frog  1812 GSSTKQFNVVVHVRPTIKPVASPVSILMHKATTLQCIASGIPNPHITWLKDGLPFNVAKANIKME 1876

  Fly  1257 LFGEDEDSLALVFQHVKPEDAGIYTCVAQTSTGNISCSAELSVQGAIQTLNREPEK----PTLVI 1317
            .||.     :|.|:....||||.|||||..:.|....:..|:|.        ||.|    ..|:.
 Frog  1877 SFGR-----SLQFKKTLLEDAGKYTCVATNAAGEAEQTIWLNVY--------EPPKIENSGELIQ 1928

  Fly  1318 EHREANASIGGSAILELQCKGFPKPAVQWKHDGEV------IQVDDRHKFMYEDEESMSLVIKNV 1376
            |...||.:|    |||.:..|.|.|.|.|..|.:.      |.|.||         ...|.|...
 Frog  1929 ETVLANHNI----ILECKATGNPDPVVTWFKDNQQLTNTGDISVSDR---------GQVLQISGA 1980

  Fly  1377 DTVDAGVYTIEAINELGQDESSINLVVKAPPKIK-KITDITCSAGETIKMEIEVEGFPQPTVQVT 1440
            ....||.|...|.:..|:.|.|.||.|..||.|. :.:.||......:::|.|..|||.|::...
 Frog  1981 QVFHAGTYKCVAASIAGRAELSYNLQVHVPPSISGRSSSITVIVNNVVRLECEATGFPAPSLTWL 2045

  Fly  1441 NNGKDVTAESN-VKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKATNDLSQTSEYWSCTVKSKP 1504
            .:|..|::.:| ::|.|.  |:     |:.:...::..||.|:..|.|...:....:..:|...|
 Frog  2046 KDGSPVSSFTNGIQILSG--GR-----VLALTNAQVGDAGKYTCVAVNAAGEQQTDYDLSVYVPP 2103

  Fly  1505 VIVKNFESEYIHGEKENVQMTV--------RIDAYPEAKLTWYHDETEIKITDSKYTVSSDGNAY 1561
            .|:         ||::|:...:        ..||.|...||||.|...: :.....|:|.||:  
 Frog  2104 NIM---------GEEQNISSLISETLILKCESDAIPPPVLTWYKDWKPL-VNRPGLTISEDGS-- 2156

  Fly  1562 TLKITGATRVDAGKYTVKATNEHGSATSSTQLLIKCAPEF--THKLKNITVAEGDSNVELVVGVD 1624
            .|||.||...|.|:|:.:|.|..|....:..:.|...|..  :.:...:.:.|| :.:.|:....
 Frog  2157 ILKIEGAQVKDTGRYSCEAVNIAGKTEKNFNVNIMVPPAIRGSAEESEVNIIEG-TLISLLCDST 2220

  Fly  1625 AYPRPHAKWYIDGIEIDEKRND----------FRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDY 1679
            ..|.|...|         |:||          .|.:..|...::|..:.:.  ..:|||...|..
 Frog  2221 GIPPPALAW---------KKNDVAIQSGAAGHIRLLSGGRQLQIITARKSD--AASYTCTASNSV 2274

  Fly  1680 GKLEDNCVVTVNCKPKVKRG---LKNVEVQEGKSFTLEVEVYSEPEAKIKWFKDGHEIYEDARIK 1741
            |.......|.|..:|.:...   ...:.|.:|.:.|||.:...:|:..:.|.|:|..:......:
 Frog  2275 GSAMKKYTVKVYVRPSISESGNHPSEIVVIQGNNVTLECDARGDPQPMLTWLKEGIPLISGNGFE 2339

  Fly  1742 ISRDTQRIENYYLTLNLARTEDAGTYEMKATNFIGETTSTCKVAVLTSEALSLEQTVTKTLIATT 1806
            ||.:.:     .|.|..|:..:||.|...|.|..|::.....:.|....|..             
 Frog  2340 ISSNGR-----LLHLQKAQISNAGLYVCVAVNVAGQSDRKYDLKVFVPPAFP------------- 2386

  Fly  1807 EEPEEGAVPEIVHVDVFQQHSYESV----PLKYEVIATGIPKPEAIWYHDGKPITPDKHTAITVD 1867
                          |...:|...|:    |.......:|||.|:..||.||.||.|.:...|...
 Frog  2387 --------------DGIMKHENISIVEKNPFTLTCEVSGIPPPKVTWYKDGNPIPPSRSPQIMSG 2437

  Fly  1868 GDHYKLEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSLSGIAEYRKPILTQGPGLKDIKVNKGDK 1932
            |  :.|......|.|.|.|...|.|..||...:.::::     ...|.:| |...::|||.:...
 Frog  2438 G--FLLRFSQSSLSDTGRYTCAVSNAAGEDMRKFDVNV-----LVPPKIT-GSVQEEIKVKERGN 2494

  Fly  1933 V---CEPVVFTADPAPEIVLLKDGQPVVETNNVK-------LKVDK------------------- 1968
            :   ||.   |..|.|:|..||||.||:|..|.:       |::..                   
 Frog  2495 ITLSCEA---TGTPIPQITWLKDGHPVLEDTNHRIDHKRQLLRISNVMMTDSGRYVCVASNPAGE 2556

  Fly  1969 ---------------KDAENG-----------LVQYTC--------------------------- 1980
                           |.|.||           .:...|                           
 Frog  2557 RSRSFSLGVLISPTIKGAINGSPEDVKVVLLSSISLECEVHSHPPATITWHKDGRLFKFKDNVRI 2621

  Fly  1981 -----TLNILEAEIKDSGRYELKVKNKYGELVTSGWIDVLAKP--------EISGLN-DTKCLPG 2031
                 ||.||:|:.||:|||.....|:.||......::|...|        |..|.: :.|.:..
 Frog  2622 LPGGRTLQILKAQEKDAGRYSCIATNEAGEGTHHYNLNVHIPPKIRKDDISEFGGFSKEIKAIVN 2686

  Fly  2032 DTICFEALVQANPKPKVSWTRGNENLCNHENCEVIADVDADKYRLVFQSVSPCEDGKYTITATNS 2096
            ........|:|||..|::|.:..:.|....:..:::.     ..|..:.....:.|:||..|:|.
 Frog  2687 TNFTLVCDVKANPLAKITWYKDGQPLEPDSHLAIVSG-----NTLYVEKAQVSDTGRYTCLASNI 2746

  Fly  2097 EGRAAVDFNLAVLV--------------EKPTFIVQPESQSIHDYRPVSTKVLVHGVPLPTIEWF 2147
            .|...:||::.:.|              :..|.....|.:.:....|.|.....:.||.|||.|:
 Frog  2747 AGEDELDFDVTIQVPPNFPKLSGLWTTSKSSTGSSNGEHKEVIINNPFSLYCETNAVPPPTITWY 2811

  Fly  2148 KDDK---PINYEAINKPGKDKLYAKEDTKKGTDQIESVLDIKSFRENDVGAYTCVATNEIGVTKA 2209
            ||||   |.| .|...||                 ..:|.|...:|:|.|.|||||.||.|....
 Frog  2812 KDDKLLTPSN-RAFILPG-----------------GHILQIARAQEDDAGTYTCVAVNEAGRDSM 2858

  Fly  2210 PFKLAMLSLAPSFV---KKLDNALDVLQGEPLVLEC--CVDGSPLPTVQWLKDGDEVKPSESIKI 2269
            .:.:.:| |.|:|.   :.|...:..|..|.|.::|  .|.|||.||:.|||||..::.......
 Frog  2859 HYNVRVL-LPPAFEGSDEDLSKDITSLVNETLEMDCTVAVTGSPAPTISWLKDGHPIQEGTRYHF 2922

  Fly  2270 STNPDGLVKLEINSCQPNDSGAYKLIISNPHG--EKVALCAVAVKPEEMQPKFLKPITSQTVVVG 2332
            .||..   .|:|...|..|:|.|..::.||.|  :|.....:.|.|..:..      .|:.|.|.
 Frog  2923 LTNGR---TLKILYAQLMDTGRYVCVVENPAGSVQKSFNLNIYVPPSVIGS------NSENVTVV 2978

  Fly  2333 EP--LKLEAQVTGFPAPEVKWYKDGMLLRPSPEINFINSPNGQIGLIIDAAQPLDAGVYKCLIAN 2395
            |.  :.|..:|||||.|.|.|.||.|:|.....:..:  |.|:. |.|...:..|.|.|.|:..|
 Frog  2979 ESNFISLTCEVTGFPPPAVSWLKDTMVLNSDSHLFIV--PGGRT-LQIPQTRLSDVGEYSCIAIN 3040

  Fly  2396 KGGEIEGVSKVEIVPKESKPVFVAELQDASSIEGFPVKMDIKVVGN----------PKPKLQWFH 2450
            :.||.:....::|.   :.|..||.::|:|:      ::::||..:          |.|.:.|:.
 Frog  3041 QAGEAKKTFFLDIY---APPSIVANVRDSST------EVNVKVNASTILECESNAIPAPVINWYK 3096

  Fly  2451 NGHEIKPDAS------------------------------------------------------- 2460
            ||..|:..:|                                                       
 Frog  3097 NGQPIRETSSYQFLEGGQRLNIRNAQVFDTGEYECIVTNVVGQDNKKFFLNVYVHPSIQGLQNEY 3161

  Fly  2461 HIAIVENP-----------------------------------DNSSSLIIEKTAPGDSGLYEVI 2490
            |..|::|.                                   ...|.:.|.:....|.|.|..:
 Frog  3162 HNGIIQNSVTFSCDAYGIPVPTLRWLKDGHPIGLTDSLEIQILSGGSKMKIARAQLTDGGTYTCL 3226

  Fly  2491 AQNPEGSTASKA---KLYVAPKADETATEEAPQFVSALRDVNADEGQ--ELVLSAPFISNPMPEV 2550
            |.|.|| ||.|.   .:.|.|..|.:         ....::|...|:  :|:.:|..|  |.|.:
 Frog  3227 ASNVEG-TAEKTYILTIQVPPSIDGS---------GMTNELNVLPGEIIQLICNAKGI--PTPVI 3279

  Fly  2551 IWSKDGVTLTPNERL--LMTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSSACNANVRKVYK 2613
            .|.|||..:|..:.|  .:|.||:.  |||...:.:|.|.|||:..||.|||....|.|   |:.
 Frog  3280 HWLKDGKHITSEDYLGINITSDGEI--LTISKTQTSDMGKYTCVATNPAGEDDRIYNVN---VFV 3339

  Fly  2614 PPVFTQKISDQQ-------QVFGNNAKIPVTVSGVPYPDLEWYFQDKPIPKSEKYSIKNDGDHHM 2671
            .|    ||.|.:       .|...:..:....||.|.|.:.|.....|:|.|.:..:::.|  .:
 Frog  3340 AP----KIDDNKGTPVVLTAVLDTSINVECHASGFPTPQINWLKNGLPLPVSSQVRLQSGG--QV 3398

  Fly  2672 LIVNNCEKGDQGVYKCIASNREG------------------KDITQGRLDIVNEIKKHSRSEPPV 2718
            |.::..:|.|...|.||||||.|                  .|:|| ::.::.        :.||
 Frog  3399 LRISRVQKSDGATYTCIASNRAGVDKKDYNIQVYVSPSLDEADVTQ-QITVIR--------DDPV 3454

  Fly  2719 FLKKIGDCDIYEGMVAKFTACATGYPEPEVEWFKNDQKLFPSDRFLIDIEPNGLLRLTIKNVTEY 2783
            .::.|                |.|.|.|.:.|.|:.::|  .|.:|..|:..|::...:|...: 
 Frog  3455 VMRCI----------------ANGVPAPRISWLKDGRQL--GDEYLPYIQSQGMVLHIVKAKMD- 3500

  Fly  2784 DVGRYSCRIFNPYGDDICH--------AELFYDSLDSQQKPLEDQYTDFKKYKKSGAPPPLSEGP 2840
            |:.||:|...|..|....|        ..:....:..:...:.:.:.|...| .:|.|||     
 Frog  3501 DIARYTCVASNAAGRVSKHFILNVMEPPHINGSEVTEELSVVVNTHLDLLCY-TTGFPPP----- 3559

  Fly  2841 IISRMTDRGLLLSWNPSVPLTPRYPITYQIEMMDLPEGDWRTLR------TGVRSCACDIRNLEP 2899
                      |::|     |....|::....|..:..|  :.||      ..|....|...|...
 Frog  3560 ----------LITW-----LKDGQPLSQNDNMHLMKAG--QVLRITSAQEENVGRFVCLASNHAG 3607

  Fly  2900 FRDYRFRVRVE---NKFGVSDPSPYTQTYRQKLVPD------PPKTYTYLPPGTDFRP------- 2948
            .....|.|:|.   |..|||.....|...::::..:      ||...|:|..|...:|       
 Frog  3608 DTKKEFLVKVHIPPNIAGVSGTQNITVLQKKQITMECKSDALPPPRITWLKDGQPLQPSPMVHIL 3672

  Fly  2949 --------------ETSPY----------FPKDF--DIERPP--HDGLAQAPQFL---LREQDIS 2982
                          :|..|          ..|:|  :|:.||  .:|.:....|:   :..:.||
 Frog  3673 SNGQFVQIDNTEVTDTGRYTCIATNIAGKTTKEFILNIQVPPSIQEGPSLVTAFVNEPITLECIS 3737

  Fly  2983 YGVKDHNTELMWFVYGYPKPKMTYYFD-DMLIESGGRFDQSYTRNGQATLFINKMLDRDVGWYEA 3046
            .||              |.||..:..| .:|.:...||  ..::||  :|:|:.:...|.|.|..
 Frog  3738 SGV--------------PLPKTAWRKDGSLLSQHNARF--LVSQNG--SLYISAVEVADSGQYFC 3784

  Fly  3047 VATNEHGEARQRVRLEIAEHPRFLKRPDETFIMARKN--GRIEAKLVGIPLPEVHWFKDWKPIVD 3109
            :|||..|.:::.:.|.:.:.||....|  |.|.|:.|  ..:..::.|.|.|::.|.|:..||  
 Frog  3785 LATNAAGSSQRHIDLLVYDPPRIKSEP--TNITAKINIQTTLPCEVTGTPKPKIQWKKNGHPI-- 3845

  Fly  3110 SSRIKISSYDPDIYVLSIHDSI------IKDGGLYSISARNIAG--SISTSVTVHIEENEDQYIY 3166
                 .:..:.::|.|....|:      :.|.|:|..||.:.||  .|...::||:...      
 Frog  3846 -----NTDLNQNMYRLLSSGSLVIISPSVDDTGIYVCSALSDAGDDEIDMYLSVHVPPT------ 3899

  Fly  3167 KTYGRHPYVRSKQLRYQDKYDIGDELGRGTQGITYHAVERSSGDNYAAKIMYGR--PELRPFMLN 3229
                                 |.||                     ||.|...:  |.:.|..::
 Frog  3900 ---------------------IADE---------------------AANIFVTKLSPAVIPCTVS 3922

  Fly  3230 ELEMMNTFNHKNLIRPYDAYDTDRSVTLIMELAAGG-ELVRDNLLRRDYYTERDIAHYIRQTLWG 3293
            .:...:....|:.|:.....|:.|.      |.:|. |:....|.....||.|.:...      |
 Frog  3923 GVPFPSVHWLKDSIQLPAISDSYRI------LPSGSLEIPSSRLSHAGKYTCRAVNQV------G 3975

  Fly  3294 LEHMHEMGVGHMGLTIKDLLISVVGGDIIKVSDFGLSRKINRHNLSTLDYGMPEFVSPEVV-NKE 3357
            ..|:      |:.|.::::.:.....|.::|.   ||..:   .|:....|.|   .|.:. .||
 Frog  3976 SAHI------HVNLHVQEVPVIKEQNDYLEVV---LSNSV---TLACEASGTP---IPTISWQKE 4025

  Fly  3358 GVNFSHDMWTVGLITYVLLGGHNPFLGI-----DDRETLTKIREGRWDFKDEIWTHISDDGRDFI 3417
            ||......      :|.:|...|  |.|     :|..|.|.|.:.                    
 Frog  4026 GVGIKSGS------SYTILSNGN--LNIASATQEDAGTYTCIAQN-------------------- 4062

  Fly  3418 SRLLLYSPEERMDVKTALKHPWFFMLDRPV---YDHDYQIGTDRLRNYYDHFRDWYANASCKNYF 3479
                        ...||||.....:...||   :..:|.|..|:                     
 Frog  4063 ------------PAGTALKKIRLKVHVPPVIVPHQKEYVISMDK--------------------- 4094

  Fly  3480 RRRRLSGCFQHPSKMVYPPGHVYTPENTPEP--------LPEPRIRAKREEVVSKYLHPDYELGL 3536
                        |.|:....|     .:|.|        :|..::..:|...... ||    :.:
 Frog  4095 ------------SIMIVCEAH-----GSPTPEIIWHKDGVPLAKLAGQRMSATGG-LH----IAV 4137

  Fly  3537 IQSESHYQYGPDTYLLQLRDVNFPVRLREYMKVAHRRSPSFALNDSVDWSLPVIRERRRFTDIMD 3601
            :|        ||       |..      ||...|...:.|  :|.|::.|:.|            
 Frog  4138 VQ--------PD-------DAG------EYTCTAENIAGS--VNSSMNLSVLV------------ 4167

  Fly  3602 EEIDDERTRSRISMYAANESYSIRRLRTELGPRLDEYTEADAMIETQREGYPPFFREKPQTIAIT 3666
                                                               ||...:..:.:::.
 Frog  4168 ---------------------------------------------------PPRIVKNIKDVSVV 4181

  Fly  3667 ENQPSHIHCFAVGDPKPCVQWFKNDMVLTESKRIKISVDEDGRSILRFEPALHFDVGVYKVVARN 3731
            .|..:.:.|.|.|.|.|.:.|.||::.:| .|..|.||...|..||  ..|.|.|||.|...|.|
 Frog  4182 INDQTTLPCAAHGIPTPTITWAKNNLPIT-VKAGKYSVLASGELIL--YNAQHKDVGTYTCTASN 4243

  Fly  3732 KVGQTVARCRIVVATLPDAPDSPEI-SANSGTEILLRWKQPRDDGHSTVLCYSLQYKLSNCDAWT 3795
            .:|:.....|:.|...|...:.|.| |.|.|..:             ::||             .
 Frog  4244 AIGEDTHTVRLTVHFPPSFTEMPTIVSLNEGERL-------------SLLC-------------K 4282

  Fly  3796 TVADNIDHEFYLLHD-----LQPNTNYQFRLASKNRIGWSEMG--IPVSASTVGGDAPKIHITKA 3853
            ...:.:.|..::..|     ||...:.|......:::.....|  :.|:.:.|......||:...
 Frog  4283 ATGNPLPHTTWIFKDKILPVLQDRRSKQQNELVIDKVSRENSGAYMCVAENIVASINTTIHVFVK 4347

  Fly  3854 MKHLQQLTENGHQVVPEEERVHTDYHCEREP-P--NWVTDSSVSDKYSFISEIARGEFSTIVKGI 3915
            ...:.....|.|:.||....:..:...:..| |  .|...:.|......|.|.:.|..:....|:
 Frog  4348 EPPVLNGVHNKHRTVPLGGNIILNCVVKGNPFPKIQWHKKAKVISYNKHIKEFSNGSLAIYDAGL 4412

  Fly  3916 QKSTDTVVVAKILEVTDENEDNVVAEFDNFKTLRHERIPALFSAYKPLN------VPIAIFVMEK 3974
            :...|...:|       .|:..|:   ::..||..:|.|.:  ...||:      ..:|:....:
 Frog  4413 EDVGDYTCIA-------ANDAGVL---EHTVTLTLQRPPTI--KVPPLDTTVDAGATVALNCQSE 4465

  Fly  3975 LQGADVLTYFSSRHEYSEQMVATVV----TQLLDA------------------------------ 4005
            .:....:|::...:..|.:...|::    .|::.|                              
 Frog  4466 GEPVPTITWYRRNNPISSEDRITILPNNSLQIVSAQKEDTSVYECKATNIMGTDVVKVTFTVQVH 4530

  Fly  4006 ---LQYLHWRG---YCHLNIQP-----DNVVMAS-----------VRSIQVKL--VD-------- 4038
               .::|.|:.   .|...||.     ||.:.|:           .||.|.||  ||        
 Frog  4531 GGFSEWLPWQSCSVTCGQGIQQRIRLCDNPLPANGGNYCQGAETETRSCQNKLCPVDGNWSEWST 4595

  Fly  4039 -------FGSAKKVNKLGMKVTPCGSLDFQPPEMINDEPIF--------------PQSDIW---- 4078
                   .||.|:.     :|..|.    .||.....:|..              |...:|    
 Frog  4596 WEECSRSCGSGKRT-----RVRTCS----DPPAQEGGKPCIGKAVDVAVCNVKPCPVHGMWGPWQ 4651

  Fly  4079 SLGALT 4084
            |.||.|
 Frog  4652 SWGACT 4657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Unc-89NP_001097440.1 RhoGEF 90..260 CDD:238091 31/179 (17%)
PH_unc89 275..388 CDD:270134 27/145 (19%)
Atrophin-1 <493..690 CDD:331285 52/260 (20%)
TonB_N 502..>596 CDD:318287 26/118 (22%)
I-set 1017..1108 CDD:333254 29/90 (32%)
I-set 1123..1212 CDD:254352 21/93 (23%)
I-set <1236..1299 CDD:333254 20/64 (31%)
I-set 1313..1403 CDD:254352 29/95 (31%)
Ig_3 1406..1487 CDD:316449 22/82 (27%)
I-set 1499..1595 CDD:254352 29/103 (28%)
I-set 1599..1690 CDD:333254 19/102 (19%)
I-set 1694..1786 CDD:254352 21/94 (22%)
I-set <1836..1903 CDD:333254 22/66 (33%)
I-set 1922..2005 CDD:333254 34/169 (20%)
I-set 2018..2108 CDD:333254 20/98 (20%)
I-set 2113..2214 CDD:333254 32/103 (31%)
I-set 2220..2302 CDD:254352 29/88 (33%)
I-set 2318..2408 CDD:254352 28/91 (31%)
I-set 2415..2506 CDD:254352 29/193 (15%)
I-set 2519..2608 CDD:254352 30/92 (33%)
I-set 2615..2696 CDD:254352 25/105 (24%)
I-set 2717..2805 CDD:254352 22/95 (23%)
FN3 2834..2925 CDD:238020 21/99 (21%)
I-set <2996..3063 CDD:333254 19/67 (28%)
I-set 3067..3157 CDD:333254 26/99 (26%)
PK_Unc-89_rpt1 3182..3440 CDD:271011 48/266 (18%)
I-set 3654..3744 CDD:333254 28/89 (31%)
FN3 3748..3840 CDD:238020 15/99 (15%)
STKc_Unc-89_rpt2 3893..4151 CDD:271014 50/289 (17%)
hmcn1XP_012816895.2 Ig strand A 2010..2015 CDD:409353 3/4 (75%)
I-set 2011..2099 CDD:400151 22/94 (23%)
Ig strand A' 2019..2025 CDD:409353 2/5 (40%)
Ig strand B 2026..2036 CDD:409353 2/9 (22%)
Ig strand C 2040..2046 CDD:409353 1/5 (20%)
Ig strand C' 2048..2050 CDD:409353 1/1 (100%)
Ig strand D 2057..2060 CDD:409353 0/2 (0%)
Ig strand E 2065..2071 CDD:409353 1/10 (10%)
Ig strand F 2077..2086 CDD:409353 4/8 (50%)
Ig strand G 2089..2101 CDD:409353 1/11 (9%)
Ig_3 2102..2177 CDD:404760 26/86 (30%)
Ig strand A 2102..2105 CDD:409353 1/2 (50%)
Ig strand A' 2111..2114 CDD:409353 1/2 (50%)
Ig strand B 2120..2127 CDD:409353 0/6 (0%)
Ig strand C 2133..2138 CDD:409353 3/4 (75%)
Ig strand C' 2141..2143 CDD:409353 0/1 (0%)
Ig strand D 2149..2153 CDD:409353 1/3 (33%)
Ig strand E 2155..2160 CDD:409353 2/6 (33%)
Ig strand F 2169..2177 CDD:409353 3/7 (43%)
Ig strand G 2180..2190 CDD:409353 1/9 (11%)
Ig 2194..2285 CDD:416386 19/102 (19%)
Ig strand A 2194..2197 CDD:409353 1/2 (50%)
Ig strand A' 2202..2207 CDD:409353 0/4 (0%)
Ig strand B 2213..2220 CDD:409353 1/6 (17%)
Ig strand C 2226..2231 CDD:409353 1/13 (8%)
Ig strand C' 2233..2235 CDD:409353 1/1 (100%)
Ig strand D 2243..2247 CDD:409353 1/3 (33%)
Ig strand E 2251..2257 CDD:409353 0/5 (0%)
Ig strand F 2264..2271 CDD:409353 3/6 (50%)
Ig strand G 2277..2285 CDD:409353 1/7 (14%)
Ig_3 2288..2366 CDD:404760 19/82 (23%)
Ig strand A' 2300..2304 CDD:409353 0/3 (0%)
Ig strand B 2308..2315 CDD:409353 3/6 (50%)
Ig strand C 2322..2327 CDD:409353 1/4 (25%)
Ig strand C' 2329..2332 CDD:409353 1/2 (50%)
Ig strand D 2337..2341 CDD:409353 0/3 (0%)
Ig strand E 2344..2351 CDD:409353 2/11 (18%)
Ig strand F 2358..2366 CDD:409353 3/7 (43%)
Ig strand B 2403..2407 CDD:409353 0/3 (0%)
Ig 2404..2473 CDD:416386 22/70 (31%)
Ig strand C 2416..2420 CDD:409353 0/3 (0%)
Ig strand E 2439..2443 CDD:409353 1/3 (33%)
Ig strand F 2453..2458 CDD:409353 1/4 (25%)
I-set 2477..2565 CDD:400151 21/91 (23%)
Ig strand B 2495..2499 CDD:409353 0/3 (0%)
Ig strand C 2508..2512 CDD:409353 1/3 (33%)
Ig strand E 2531..2535 CDD:409353 1/3 (33%)
Ig strand F 2545..2550 CDD:409353 0/4 (0%)
Ig 2579..2660 CDD:416386 14/80 (18%)
Ig strand A' 2579..2584 CDD:409353 0/4 (0%)
Ig strand B 2590..2597 CDD:409353 1/6 (17%)
Ig strand C 2603..2608 CDD:409353 0/4 (0%)
Ig strand C' 2610..2612 CDD:409353 0/1 (0%)
Ig strand D 2619..2622 CDD:409353 0/2 (0%)
Ig strand E 2626..2632 CDD:409353 3/5 (60%)
Ig strand F 2639..2646 CDD:409353 3/6 (50%)
Ig strand G 2652..2660 CDD:409353 0/7 (0%)
I-set 2673..2758 CDD:400151 19/89 (21%)
Ig strand B 2689..2693 CDD:409353 0/3 (0%)
Ig strand C 2702..2706 CDD:409353 1/3 (33%)
Ig strand E 2725..2728 CDD:409353 1/2 (50%)
Ig strand F 2738..2743 CDD:409353 2/4 (50%)
Ig strand B 2794..2798 CDD:409353 1/3 (33%)
Ig 2795..2857 CDD:416386 29/79 (37%)
Ig strand C 2807..2811 CDD:409353 2/3 (67%)
Ig strand E 2830..2834 CDD:409353 1/3 (33%)
Ig strand F 2844..2849 CDD:409353 3/4 (75%)
I-set 2878..2961 CDD:400151 27/85 (32%)
Ig strand A' 2886..2889 CDD:409353 1/2 (50%)
Ig strand C 2904..2909 CDD:409353 2/4 (50%)
Ig strand C' 2911..2913 CDD:409353 1/1 (100%)
Ig strand D 2919..2923 CDD:409353 0/3 (0%)
Ig strand E 2926..2932 CDD:409353 1/8 (13%)
Ig strand F 2940..2948 CDD:409353 2/7 (29%)
Ig_3 2964..3040 CDD:404760 26/84 (31%)
Ig strand A 2967..2970 CDD:409353 0/2 (0%)
Ig strand A' 2974..2977 CDD:409353 1/2 (50%)
Ig strand B 2983..2990 CDD:409353 1/6 (17%)
Ig strand C 2996..3001 CDD:409353 2/4 (50%)
Ig strand D 3011..3015 CDD:409353 0/3 (0%)
Ig strand E 3018..3024 CDD:409353 2/6 (33%)
Ig strand F 3032..3040 CDD:409353 3/7 (43%)
Ig strand G 3043..3053 CDD:409353 2/9 (22%)
Ig strand A 3056..3061 CDD:409353 1/4 (25%)
Ig strand A' 3067..3073 CDD:409353 1/11 (9%)
I-set 3070..3148 CDD:400151 9/77 (12%)
Ig strand B 3076..3086 CDD:409353 0/9 (0%)
Ig strand C 3090..3096 CDD:409353 2/5 (40%)
Ig strand C' 3098..3100 CDD:409353 1/1 (100%)
Ig strand D 3106..3109 CDD:409353 1/2 (50%)
Ig strand E 3114..3120 CDD:409353 0/5 (0%)
Ig strand F 3126..3135 CDD:409353 0/8 (0%)
Ig strand G 3138..3150 CDD:409353 0/11 (0%)
Ig 3169..3242 CDD:416386 12/73 (16%)
Ig strand B 3170..3174 CDD:409353 0/3 (0%)
Ig strand C 3183..3187 CDD:409353 0/3 (0%)
Ig strand E 3208..3212 CDD:409353 1/3 (33%)
Ig strand F 3222..3227 CDD:409353 1/4 (25%)
Ig strand A 3245..3250 CDD:409353 1/4 (25%)
Ig strand A' 3254..3260 CDD:409353 1/5 (20%)
I-set 3259..3329 CDD:400151 26/73 (36%)
Ig strand B 3263..3273 CDD:409353 2/9 (22%)
Ig strand C 3277..3283 CDD:409353 2/5 (40%)
Ig strand C' 3285..3287 CDD:409353 1/1 (100%)
Ig strand D 3295..3298 CDD:409353 0/2 (0%)
Ig strand E 3303..3309 CDD:409353 3/7 (43%)
Ig strand F 3315..3324 CDD:409353 4/8 (50%)
Ig strand G 3327..3339 CDD:409353 6/14 (43%)
I-set 3341..3431 CDD:400151 25/95 (26%)
Ig strand B 3361..3368 CDD:409353 0/6 (0%)
Ig strand C 3374..3379 CDD:409353 1/4 (25%)
Ig strand C' 3381..3383 CDD:409353 0/1 (0%)
Ig strand D 3389..3393 CDD:409353 0/3 (0%)
Ig strand E 3397..3402 CDD:409353 1/4 (25%)
Ig strand F 3411..3417 CDD:409353 3/5 (60%)
Ig 3444..3524 CDD:416386 23/107 (21%)
Ig strand A' 3445..3448 CDD:409353 0/2 (0%)
Ig strand B 3454..3461 CDD:409353 2/22 (9%)
Ig strand C 3467..3472 CDD:409353 1/4 (25%)
Ig strand C' 3474..3476 CDD:409353 0/1 (0%)
Ig strand D 3481..3486 CDD:409353 1/4 (25%)
Ig strand E 3489..3495 CDD:409353 1/5 (20%)
Ig strand F 3503..3511 CDD:409353 3/7 (43%)
Ig strand G 3514..3524 CDD:409353 2/9 (22%)
Ig strand A 3527..3532 CDD:409353 0/4 (0%)
Ig strand A' 3536..3542 CDD:409353 0/5 (0%)
Ig 3539..3617 CDD:416386 19/100 (19%)
Ig strand B 3545..3555 CDD:409353 2/10 (20%)
Ig strand C 3559..3565 CDD:409353 3/25 (12%)
Ig strand C' 3567..3569 CDD:409353 0/1 (0%)
vWFA 43..199 CDD:238119
MD 295..418 CDD:214741
IGc2 446..507 CDD:197706
Ig strand B 449..452 CDD:409353
Ig strand C 461..465 CDD:409353
Ig strand E 483..487 CDD:409353
Ig strand F 497..502 CDD:409353
Ig strand G 511..514 CDD:409353
Ig 521..608 CDD:416386
Ig strand A' 529..532 CDD:409353
Ig strand B 538..545 CDD:409353
Ig strand C 551..556 CDD:409353
Ig strand C' 558..560 CDD:409353
Ig strand D 568..572 CDD:409353
Ig strand E 575..580 CDD:409353
Ig strand F 588..596 CDD:409353
Ig strand G 599..607 CDD:409353
I-set 613..691 CDD:400151
Ig strand A' 621..624 CDD:409353
Ig strand B 630..637 CDD:409353
Ig strand C 643..648 CDD:409353
Ig strand C' 650..652 CDD:409353
Ig strand D 658..663 CDD:409353
Ig strand E 665..669 CDD:409353
Ig strand F 678..686 CDD:409353
Ig strand G 689..700 CDD:409353
Ig_3 703..777 CDD:404760
Ig strand A' 709..714 CDD:409353
Ig strand B 718..725 CDD:409353
Ig strand C 733..737 CDD:409353
Ig strand D 749..752 CDD:409353
Ig strand E 756..761 CDD:409353
Ig strand F 769..777 CDD:409353
Ig strand G 783..790 CDD:409353
I-set 794..885 CDD:400151 14/67 (21%)
Ig strand A 794..797 CDD:409353
Ig strand A' 802..805 CDD:409353
Ig strand B 811..818 CDD:409353
Ig strand C 824..835 CDD:409353 4/15 (27%)
Ig strand C' 838..840 CDD:409353 0/1 (0%)
Ig strand D 845..849 CDD:409353 0/3 (0%)
Ig strand E 851..855 CDD:409353 1/3 (33%)
Ig strand F 864..872 CDD:409353 1/7 (14%)
Ig strand G 875..885 CDD:409353 0/10 (0%)
Ig_3 891..965 CDD:404760 22/128 (17%)
Ig strand A' 899..901 CDD:409353 0/1 (0%)
Ig strand B 907..915 CDD:409353 1/7 (14%)
Ig strand C 922..927 CDD:409353 2/4 (50%)
Ig strand C' 929..932 CDD:409353 1/2 (50%)
Ig strand D 937..941 CDD:409353 0/22 (0%)
Ig strand E 944..950 CDD:409353 4/16 (25%)
Ig strand F 957..965 CDD:409353 1/7 (14%)
Ig strand G 968..972 CDD:409353 0/3 (0%)
Ig strand G' 974..978 CDD:409353 0/3 (0%)
PHA02785 991..1258 CDD:165149 67/342 (20%)
Ig 1268..1355 CDD:416386 17/89 (19%)
Ig strand A' 1272..1275 CDD:409353 0/2 (0%)
Ig strand B 1284..1291 CDD:409353 2/6 (33%)
Ig strand C 1297..1302 CDD:409353 1/4 (25%)
Ig strand C' 1305..1307 CDD:409353 2/4 (50%)
Ig strand D 1313..1319 CDD:409353 0/5 (0%)
Ig strand E 1321..1325 CDD:409353 0/3 (0%)
Ig strand F 1334..1342 CDD:409353 0/7 (0%)
Ig strand G 1345..1355 CDD:409353 2/9 (22%)
Ig 1366..1448 CDD:416386 20/90 (22%)
Ig strand B 1378..1382 CDD:409353 1/3 (33%)
Ig strand C 1391..1395 CDD:409353 1/3 (33%)
Ig strand E 1413..1418 CDD:409353 0/4 (0%)
Ig strand F 1428..1433 CDD:409353 2/12 (17%)
Ig strand G 1442..1445 CDD:409353 0/2 (0%)
I-set 1457..1542 CDD:400151 20/119 (17%)
Ig strand A' 1462..1465 CDD:409353 0/2 (0%)
Ig strand B 1471..1478 CDD:409353 1/6 (17%)
Ig strand C 1484..1489 CDD:409353 1/12 (8%)
Ig strand C' 1491..1493 CDD:409353 0/1 (0%)
Ig strand D 1500..1504 CDD:409353 0/3 (0%)
Ig strand E 1507..1513 CDD:409353 1/20 (5%)
Ig strand F 1521..1529 CDD:409353 2/7 (29%)
Ig strand G 1532..1542 CDD:409353 2/9 (22%)
Ig 1565..1629 CDD:416386 19/128 (15%)
Ig strand B 1565..1569 CDD:409353 0/3 (0%)
Ig strand C 1578..1582 CDD:409353 1/3 (33%)
Ig strand E 1601..1605 CDD:409353 1/14 (7%)
Ig strand F 1615..1620 CDD:409353 2/5 (40%)
I-set 1649..1729 CDD:400151 30/93 (32%)
Ig strand B 1659..1666 CDD:409353 1/6 (17%)
Ig strand C 1672..1677 CDD:409353 3/4 (75%)
Ig strand D 1688..1691 CDD:409353 1/5 (20%)
Ig strand E 1695..1701 CDD:409353 2/5 (40%)
Ig strand F 1708..1715 CDD:409353 3/6 (50%)
Ig strand G 1721..1729 CDD:409353 1/7 (14%)
I-set 1741..1822 CDD:400151 21/92 (23%)
Ig strand A' 1743..1746 CDD:409353 1/2 (50%)
Ig strand B 1752..1759 CDD:409353 0/6 (0%)
Ig strand C 1765..1770 CDD:409353 1/4 (25%)
Ig strand C' 1772..1774 CDD:409353 0/1 (0%)
Ig strand D 1780..1784 CDD:409353 2/4 (50%)
Ig strand E 1787..1793 CDD:409353 1/9 (11%)
Ig strand F 1801..1809 CDD:409353 3/7 (43%)
Ig <1844..1914 CDD:416386 22/74 (30%)
Ig strand C 1856..1860 CDD:409353 0/3 (0%)
Ig strand C' 1863..1866 CDD:409353 1/2 (50%)
Ig strand D 1872..1876 CDD:409353 1/3 (33%)
Ig strand E 1880..1885 CDD:409353 1/9 (11%)
Ig strand F 1893..1901 CDD:409353 6/7 (86%)
Ig strand G 1904..1914 CDD:409353 2/9 (22%)
Ig 1937..2007 CDD:416386 25/82 (30%)
Ig strand B 1937..1941 CDD:409353 3/7 (43%)
Ig strand C 1950..1954 CDD:409353 1/3 (33%)
Ig strand E 1973..1977 CDD:409353 1/3 (33%)
Ig strand F 1987..1992 CDD:409353 1/4 (25%)
Ig strand D 3576..3579 CDD:409353 1/2 (50%)
Ig strand E 3583..3589 CDD:409353 2/5 (40%)
Ig strand F 3595..3604 CDD:409353 2/8 (25%)
Ig strand G 3607..3617 CDD:409353 2/9 (22%)
I-set 3630..3710 CDD:400151 11/79 (14%)
Ig strand A' 3631..3634 CDD:409353 0/2 (0%)
Ig strand B 3640..3647 CDD:409353 0/6 (0%)
Ig strand C 3653..3658 CDD:409353 1/4 (25%)
Ig strand C' 3660..3662 CDD:409353 1/1 (100%)
Ig strand D 3668..3672 CDD:409353 0/3 (0%)
Ig strand E 3675..3681 CDD:409353 0/5 (0%)
Ig strand F 3689..3697 CDD:409353 1/7 (14%)
Ig_3 3713..3788 CDD:404760 23/92 (25%)
Ig strand A' 3722..3725 CDD:409353 0/2 (0%)
Ig strand B 3731..3738 CDD:409353 1/6 (17%)
Ig strand C 3744..3749 CDD:409353 1/4 (25%)
Ig strand C' 3751..3753 CDD:409353 0/1 (0%)
Ig strand D 3760..3764 CDD:409353 2/5 (40%)
Ig strand E 3767..3772 CDD:409353 2/6 (33%)
Ig strand F 3780..3788 CDD:409353 3/7 (43%)
Ig strand G 3791..3801 CDD:409353 2/9 (22%)
Ig_3 3804..3879 CDD:404760 20/83 (24%)
Ig strand B 3823..3826 CDD:409353 0/2 (0%)
Ig strand C 3835..3839 CDD:409353 0/3 (0%)
Ig strand E 3860..3864 CDD:409353 1/3 (33%)
Ig strand F 3874..3879 CDD:409353 1/4 (25%)
Ig strand A' 3906..3909 CDD:409353 1/2 (50%)
Ig 3908..3985 CDD:416386 17/94 (18%)
Ig strand B 3915..3922 CDD:409353 1/6 (17%)
Ig strand C 3928..3933 CDD:409353 0/4 (0%)
Ig strand C' 3935..3937 CDD:409353 0/1 (0%)
Ig strand D 3944..3948 CDD:409353 1/9 (11%)
Ig strand E 3951..3956 CDD:409353 2/4 (50%)
Ig strand F 3964..3972 CDD:409353 3/7 (43%)
Ig strand G 3975..3985 CDD:409353 4/15 (27%)
I-set 3989..4075 CDD:400151 25/134 (19%)
Ig strand B 4006..4013 CDD:409353 1/9 (11%)
Ig strand C 4019..4024 CDD:409353 0/4 (0%)
Ig strand C' 4026..4028 CDD:409353 1/1 (100%)
Ig strand D 4034..4038 CDD:409353 1/3 (33%)
Ig strand E 4041..4046 CDD:409353 2/6 (33%)
Ig strand F 4054..4062 CDD:409353 3/7 (43%)
Ig strand G 4065..4075 CDD:409353 4/9 (44%)
Ig_3 4078..4152 CDD:404760 21/137 (15%)
Ig strand C 4109..4113 CDD:409353 0/3 (0%)
Ig strand C' 4116..4119 CDD:409353 0/2 (0%)
Ig strand D 4126..4129 CDD:409353 1/2 (50%)
Ig strand E 4131..4136 CDD:409353 2/9 (22%)
Ig strand F 4144..4152 CDD:409353 3/13 (23%)
Ig strand G 4155..4165 CDD:409353 3/11 (27%)
Ig strand A 4168..4171 CDD:409353 2/2 (100%)
I-set 4169..4256 CDD:400151 28/89 (31%)
Ig strand A' 4177..4180 CDD:409353 0/2 (0%)
Ig strand B 4185..4193 CDD:409353 1/7 (14%)
Ig strand C 4199..4203 CDD:409353 0/3 (0%)
Ig strand C' 4206..4209 CDD:409353 0/2 (0%)
Ig strand D 4215..4219 CDD:409353 2/3 (67%)
Ig strand E 4222..4227 CDD:409353 3/6 (50%)
Ig strand F 4235..4243 CDD:409353 3/7 (43%)
Ig strand G 4246..4256 CDD:409353 2/9 (22%)
Ig_3 4259..4333 CDD:404760 15/99 (15%)
putative Ig strand A 4260..4266 CDD:409353 1/5 (20%)
Ig strand B 4277..4281 CDD:409353 0/16 (0%)
Ig strand C 4290..4295 CDD:409353 1/4 (25%)
Ig strand E 4312..4316 CDD:409353 0/3 (0%)
Ig strand F 4326..4331 CDD:409353 0/4 (0%)
Ig strand G 4339..4342 CDD:409353 0/2 (0%)
Ig 4358..4436 CDD:416386 16/87 (18%)
Ig strand B 4368..4375 CDD:409353 0/6 (0%)
Ig strand C 4381..4386 CDD:409353 1/4 (25%)
Ig strand C' 4388..4390 CDD:409353 0/1 (0%)
Ig strand D 4396..4400 CDD:409353 1/3 (33%)
Ig strand E 4403..4408 CDD:409353 1/4 (25%)
Ig strand F 4416..4424 CDD:409353 2/14 (14%)
Ig strand G 4427..4436 CDD:409353 2/11 (18%)
Ig 4443..4527 CDD:416386 8/85 (9%)
Ig strand A' 4449..4452 CDD:409353 0/2 (0%)
Ig strand B 4458..4465 CDD:409353 1/6 (17%)
Ig strand C 4471..4476 CDD:409353 1/4 (25%)
Ig strand C' 4478..4480 CDD:409353 0/1 (0%)
Ig strand D 4486..4490 CDD:409353 1/3 (33%)
Ig strand E 4493..4498 CDD:409353 1/4 (25%)
Ig strand F 4506..4514 CDD:409353 0/7 (0%)
Ig strand G 4517..4527 CDD:409353 0/9 (0%)
TSP1 4534..4585 CDD:214559 13/50 (26%)
TSP1 4590..4642 CDD:214559 8/60 (13%)
TSP1 4647..4699 CDD:214559 5/11 (45%)
TSP1 4704..4756 CDD:214559
TSP1 4761..4813 CDD:214559
TSP1 4818..4870 CDD:214559
nidG2 4869..5093 CDD:412205
cEGF 5128..5151 CDD:403760
EGF_CA 5148..5183 CDD:214542
EGF_CA 5193..5230 CDD:214542
EGF_CA 5231..5272 CDD:214542
EGF_CA 5273..5314 CDD:311536
EGF_CA 5316..5355 CDD:214542
EGF_CA 5356..>5391 CDD:214542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2879
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.