DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vmat and Slc18a2

DIOPT Version :10

Sequence 1:NP_001014525.1 Gene:Vmat / 3346192 FlyBaseID:FBgn0260964 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_766111.1 Gene:Slc18a2 / 214084 MGIID:106677 Length:517 Species:Mus musculus


Alignment Length:37 Identity:13/37 - (35%)
Similarity:15/37 - (40%) Gaps:4/37 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KVRKAPKKVQKVSKYPASLL----TAGLYRAVRSRMV 49
            ||....|..|:.:..|..|.    .|.||||..|..|
Mouse    27 KVPDKQKLFQEANGVPVHLKGGVGDAVLYRATMSLTV 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VmatNP_001014525.1 MFS_SLC18A1_2_VAT1_2 141..578 CDD:340942
Slc18a2NP_766111.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..119
MFS_SLC18A1_2_VAT1_2 126..474 CDD:340942
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.