DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vkor and VKORC1

DIOPT Version :9

Sequence 1:NP_001014533.1 Gene:Vkor / 3346188 FlyBaseID:FBgn0053544 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001298240.1 Gene:VKORC1 / 79001 HGNCID:23663 Length:191 Species:Homo sapiens


Alignment Length:167 Identity:57/167 - (34%)
Similarity:81/167 - (48%) Gaps:37/167 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ICVCGLAISVYSLYVKMKLKEDENYRPMCDVNDNISCSLVFKSGYGDGFG-----LGNITQVNAP 73
            :|:.||.:|:|:|:||.....|.:||.:|||...||||.||.|.:|.|||     ||..:.:|..
Human    15 LCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVLGQDSILNQS 79

  Fly    74 NGAIGCAFYILYFLSSFFNH----------------------------RWLCLVQLIVCTLTLLL 110
            |...||.||.|..|....:.                            ||..::.|:...::|..
Human    80 NSIFGCIFYTLQLLLEMVSRHVAQAGLKQSVCLSLPKCWGDYRRCLRTRWASVLMLLSSLVSLAG 144

  Fly   111 CVYLGFLLILVFYDFCLVCVTIYFIHT---WL-FQEV 143
            .|||.::|..|.||||:||:|.|.|:.   || |::|
Human   145 SVYLAWILFFVLYDFCIVCITTYAINVSLMWLSFRKV 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VkorNP_001014533.1 VKOR_euk 9..135 CDD:240600 52/153 (34%)
VKORC1NP_001298240.1 VKOR_euk 10..177 CDD:240600 54/161 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149495
Domainoid 1 1.000 108 1.000 Domainoid score I6433
eggNOG 1 0.900 - - E1_2CUJS
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11416
Inparanoid 1 1.050 108 1.000 Inparanoid score I4920
Isobase 1 0.950 - 0 Normalized mean entropy S6587
OMA 1 1.010 - - QHG56761
OrthoDB 1 1.010 - - D1611169at2759
OrthoFinder 1 1.000 - - FOG0004048
OrthoInspector 1 1.000 - - otm41842
orthoMCL 1 0.900 - - OOG6_104802
Panther 1 1.100 - - O PTHR14519
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4888
SonicParanoid 1 1.000 - - X2796
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.