DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vkor and vkorc1l1

DIOPT Version :9

Sequence 1:NP_001014533.1 Gene:Vkor / 3346188 FlyBaseID:FBgn0053544 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001018524.1 Gene:vkorc1l1 / 553717 ZFINID:ZDB-GENE-050522-210 Length:175 Species:Danio rerio


Alignment Length:144 Identity:53/144 - (36%)
Similarity:82/144 - (56%) Gaps:7/144 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ICVCGLAISVYSLYVKMKLKEDENYRPMCDVNDNISCSLVFKSGYGDGFGL-----GNITQVNAP 73
            :|:.|:.:|:||.:|:.:...|.|||.|||::.:||||.||.|.:|.||||     ||.:.||.|
Zfish    21 VCLSGILLSLYSFHVEREKTRDANYRAMCDLSSSISCSKVFTSRWGRGFGLLGSIFGNDSAVNQP 85

  Fly    74 NGAIGCAFYILYFLSSFFNHRWLCLVQLIVCTLTLLLCVYLGFLLILVFYDFCLVCVTIYFIHTW 138
            |...|..||:...|..........|:.:.....:::..:|||::|..|..|||::|:|.|.::..
Zfish    86 NSVYGIFFYVFQLLLGLTASAMAALILMTTSIASVMGSLYLGYILYFVLKDFCVICITTYALNFI 150

  Fly   139 LFQEVLRRYRRLYM 152
            ||  ||...|.:|:
Zfish   151 LF--VLNYKRLVYL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VkorNP_001014533.1 VKOR_euk 9..135 CDD:240600 47/125 (38%)
vkorc1l1NP_001018524.1 VKOR_euk 17..155 CDD:240600 50/135 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6802
eggNOG 1 0.900 - - E1_2CUJS
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4937
OMA 1 1.010 - - QHG56761
OrthoDB 1 1.010 - - D1611169at2759
OrthoFinder 1 1.000 - - FOG0004048
OrthoInspector 1 1.000 - - otm25189
orthoMCL 1 0.900 - - OOG6_104802
Panther 1 1.100 - - LDO PTHR14519
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4888
SonicParanoid 1 1.000 - - X2796
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.