DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vkor and vkorc1l1

DIOPT Version :9

Sequence 1:NP_001014533.1 Gene:Vkor / 3346188 FlyBaseID:FBgn0053544 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001016769.2 Gene:vkorc1l1 / 549523 XenbaseID:XB-GENE-944095 Length:175 Species:Xenopus tropicalis


Alignment Length:142 Identity:48/142 - (33%)
Similarity:80/142 - (56%) Gaps:8/142 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ICVCGLAISVYSLYVKMKLKEDENYRPMCDVNDNISCSLVFKSGYGDGFG-LGNI----TQVNAP 73
            :||.|:.:|:|:.:|:.:.:.|..|:.:||.|:.:.||.|..|.:|.||| ||:|    :.:|.|
 Frog    21 VCVLGIVLSIYAFHVEREKERDPGYKAICDFNEWVHCSTVLSSRWGRGFGMLGSIFGKDSLLNQP 85

  Fly    74 NGAIGCAFYILYFLSSFFNHRWLCLVQLIVCTLTLLLCVYLGFLLILVFYDFCLVCVTIYFIHTW 138
            |...|..||:|..|..........||.:....::::..|||.::|..|..|||::|||.|.::  
 Frog    86 NSVFGLVFYLLQMLLGMTVSAVAALVLMTSSIVSVVGSVYLAYILYFVLKDFCVICVTTYLLN-- 148

  Fly   139 LFQEVLRRYRRL 150
             |..::..|:||
 Frog   149 -FILLIINYKRL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VkorNP_001014533.1 VKOR_euk 9..135 CDD:240600 44/125 (35%)
vkorc1l1NP_001016769.2 VKOR_euk 17..155 CDD:240600 45/136 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I7583
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I4944
OMA 1 1.010 - - QHG56761
OrthoDB 1 1.010 - - D1611169at2759
OrthoFinder 1 1.000 - - FOG0004048
OrthoInspector 1 1.000 - - otm49064
Panther 1 1.100 - - LDO PTHR14519
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4888
SonicParanoid 1 1.000 - - X2796
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.