DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vkor and Vkorc1l1

DIOPT Version :9

Sequence 1:NP_001014533.1 Gene:Vkor / 3346188 FlyBaseID:FBgn0053544 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_976083.1 Gene:Vkorc1l1 / 399684 RGDID:1303249 Length:176 Species:Rattus norvegicus


Alignment Length:142 Identity:43/142 - (30%)
Similarity:74/142 - (52%) Gaps:8/142 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ICVCGLAISVYSLYVKMKLKEDENYRPMCDVNDNISCSLVFKSGYGDGFGL-----GNITQVNAP 73
            :|..|:.:|:|:.:|:.:.:.|..:|.:||:...:.||....|.:|.||||     |....:|.|
  Rat    22 VCAAGILLSIYAYHVEREKERDPEHRALCDLGPWVKCSAALASRWGRGFGLLGSIFGKDGVLNQP 86

  Fly    74 NGAIGCAFYILYFLSSFFNHRWLCLVQLIVCTLTLLLCVYLGFLLILVFYDFCLVCVTIYFIHTW 138
            |...|..||||..|..........||.:....::::..:||.::|..|..:||::|||.|.::  
  Rat    87 NSVFGLIFYILQLLLGMTASAVAALVLMTSSIVSVVGSLYLAYILYFVLKEFCIICVTTYVLN-- 149

  Fly   139 LFQEVLRRYRRL 150
             |..::..|:||
  Rat   150 -FLLLIINYKRL 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VkorNP_001014533.1 VKOR_euk 9..135 CDD:240600 39/125 (31%)
Vkorc1l1NP_976083.1 VKOR_euk 18..156 CDD:240600 40/136 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 105 1.000 Domainoid score I6516
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I4819
OMA 1 1.010 - - QHG56761
OrthoDB 1 1.010 - - D1611169at2759
OrthoFinder 1 1.000 - - FOG0004048
OrthoInspector 1 1.000 - - otm45979
orthoMCL 1 0.900 - - OOG6_104802
Panther 1 1.100 - - LDO PTHR14519
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2796
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.