DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vkor and Vkorc1

DIOPT Version :9

Sequence 1:NP_001014533.1 Gene:Vkor / 3346188 FlyBaseID:FBgn0053544 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_976080.1 Gene:Vkorc1 / 309004 RGDID:1303107 Length:161 Species:Rattus norvegicus


Alignment Length:153 Identity:58/153 - (37%)
Similarity:87/153 - (56%) Gaps:10/153 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEQAYSTASRLR-GICVCGLAISVYSLYVKMKLKEDENYRPMCDVNDNISCSLVFKSGYGDGFG- 63
            |...:.:..||| .:|:.|||:|:|:|:||.....:|:||.:|||...||||.||.|.:|.||| 
  Rat     1 MGTTWRSPGRLRLALCLAGLALSLYALHVKAARARNEDYRALCDVGTAISCSRVFSSRWGRGFGL 65

  Fly    64 ----LGNITQVNAPNGAIGCAFYILYFLSSFFNHRWLCLVQLIVCTLTLLLCVYLGFLLILVFYD 124
                ||..:.:|..|...||.||.:..|......||..::.::...:::...:||.::|..|.||
  Rat    66 VEHVLGADSILNQSNSIFGCMFYTIQLLLGCLRGRWASILLILSSLVSVAGSLYLAWILFFVLYD 130

  Fly   125 FCLVCVTIYFIHTWL----FQEV 143
            ||:||:|.|.|:..|    ||:|
  Rat   131 FCIVCITTYAINAGLMLLSFQKV 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VkorNP_001014533.1 VKOR_euk 9..135 CDD:240600 52/131 (40%)
Vkorc1NP_976080.1 VKOR_euk 25..149 CDD:240600 46/123 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343372
Domainoid 1 1.000 105 1.000 Domainoid score I6516
eggNOG 1 0.900 - - E1_2CUJS
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11416
Inparanoid 1 1.050 108 1.000 Inparanoid score I4819
OMA 1 1.010 - - QHG56761
OrthoDB 1 1.010 - - D1611169at2759
OrthoFinder 1 1.000 - - FOG0004048
OrthoInspector 1 1.000 - - otm45979
orthoMCL 1 0.900 - - OOG6_104802
Panther 1 1.100 - - O PTHR14519
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2796
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.