DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33506 and TMEM177

DIOPT Version :9

Sequence 1:NP_001014528.1 Gene:CG33506 / 3346177 FlyBaseID:FBgn0053506 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001098668.1 Gene:TMEM177 / 80775 HGNCID:28143 Length:311 Species:Homo sapiens


Alignment Length:278 Identity:70/278 - (25%)
Similarity:126/278 - (45%) Gaps:8/278 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GLFLGNFLPHTFGLKYYRDFVQCYQHGVGRPVPEAVQQRLEKALDQLGVTPFERKFVKPFTVFGF 98
            |||......|.|.....:...|.:..|...|:|..:|...::.|..:|| |....: ||||.|.|
Human    26 GLFGVPISYHLFPDPVVQWLYQYWPQGQPAPLPPQLQSLFQEVLQDIGV-PSGHCY-KPFTTFTF 88

  Fly    99 DVFQAGTTKFRFGGALGIPVNYGYDSLEEIKRADIRFRDKQINWSSPSGKLLEEAIVLNEDEQIF 163
            ....||..:...|..:|||.::..|.:..... .:......::|.||:|..|..::.|:.:.|.|
Human    89 QPVSAGFPRLPAGAVVGIPASFLGDLVINTNH-PVVIHGHTVDWRSPAGARLRASLTLSREAQKF 152

  Fly   164 GLSKAVLQMQTHRVLLNSIFPSVSFLMVYTMGHYLNLRLDLFARHGSVRFVLYSILGLFGLGLWS 228
            .|::.|:.:::....::::.........:.:|......|.|.|...::|.....:..:.|...::
Human   153 ALAREVVYLESSTTAVHALLAPACLAGTWALGVGAKYTLGLHAGPMNLRAAFSLVAAVAGFVAYA 217

  Fly   229 FMKDYNQVSTDAEIDQRLATMGPQLVAAGASFYDKHLKKNIALRELIGND---VYTALGN--ENY 288
            |.:|....:.::.:|:|.|::.......|..||:|.|..|:|||.|:|.|   :||..||  ..:
Human   218 FSQDSLTHAVESWLDRRTASLSAAYACGGVEFYEKLLSGNLALRSLLGKDGEKLYTPSGNIVPRH 282

  Fly   289 MIRQKSMPLTARKSFFLE 306
            :.|.|.:|.|.|:...|:
Human   283 LFRIKHLPYTTRRDSVLQ 300



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159959
Domainoid 1 1.000 99 1.000 Domainoid score I7163
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12732
Inparanoid 1 1.050 99 1.000 Inparanoid score I5019
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49799
OrthoDB 1 1.010 - - D1039066at2759
OrthoFinder 1 1.000 - - FOG0008357
OrthoInspector 1 1.000 - - oto88428
orthoMCL 1 0.900 - - OOG6_108926
Panther 1 1.100 - - LDO PTHR21824
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4881
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.900

Return to query results.
Submit another query.