DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33506 and tmem177

DIOPT Version :9

Sequence 1:NP_001014528.1 Gene:CG33506 / 3346177 FlyBaseID:FBgn0053506 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_955888.1 Gene:tmem177 / 556875 ZFINID:ZDB-GENE-030131-993 Length:310 Species:Danio rerio


Alignment Length:288 Identity:72/288 - (25%)
Similarity:128/288 - (44%) Gaps:19/288 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GLFLGNFLPHTFGLKYYRDFVQCYQHGVGRPVPEAVQQRLEKALDQLGVTPFERKFVKPFTVFGF 98
            |:|..|...|.|....|:...|.:..|....:.|.:|...::.|....::....  ...|..|||
Zfish    26 GVFSANIFYHIFPDHTYKKVYQAWHKGEPASLSEKLQNIFQEVLKDSSISTSGN--FSAFAAFGF 88

  Fly    99 DVFQAGTTKFRFGGALGIPVNYGYDS--LEEIKRADIRFRDKQINWSSPSGKLLEEAIVLNEDEQ 161
            ....||......|..:|||.|:...:  ||.|....|....|::.|.|.||..|:.::|.:.:.|
Zfish    89 HPVGAGVPWLPSGAQIGIPANFNSSTADLEGITNRTILINGKELEWDSDSGVALKNSLVFSLEAQ 153

  Fly   162 IFGLSKAVLQMQTHRVLLNSIFPSVSF--LMVYTMGHYLNLRLDLFARHGSVRF-VLYSILGLFG 223
            .|.:::.|.::.:...:|::....|..  ..||::.    |:.....:.||:.| .:.::|.| |
Zfish   154 KFAIAREVARLGSGGPILHAAVAPVCLAGACVYSVA----LKQIFRFQAGSIIFRGVVNLLSL-G 213

  Fly   224 LGLWSFMKDYNQVS--TDAEIDQRLATMGPQLVAAGASFYDKHLKKNIALRELI---GNDVYTAL 283
            ||:.:::...:.||  .|...|:|.|.:.......|..||:|.|.:|..||.|:   |.::|...
Zfish   214 LGVMTYVLAADSVSQWLDYRSDRRAAGLSRDYAKGGLEFYEKILTRNKTLRSLMGQKGEEMYAPS 278

  Fly   284 GN--ENYMIRQKSMPLTARKSFFLEKLE 309
            ||  ..::::.:....|:|:...|..|:
Zfish   279 GNLFPAHLLQLRHATYTSRRDRILNLLK 306



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596249
Domainoid 1 1.000 79 1.000 Domainoid score I8686
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12732
Inparanoid 1 1.050 79 1.000 Inparanoid score I5228
OMA 1 1.010 - - QHG49799
OrthoDB 1 1.010 - - D1039066at2759
OrthoFinder 1 1.000 - - FOG0008357
OrthoInspector 1 1.000 - - oto41263
orthoMCL 1 0.900 - - OOG6_108926
Panther 1 1.100 - - LDO PTHR21824
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4881
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.900

Return to query results.
Submit another query.