DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33506 and U3-55K

DIOPT Version :9

Sequence 1:NP_001014528.1 Gene:CG33506 / 3346177 FlyBaseID:FBgn0053506 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001014529.1 Gene:U3-55K / 3346176 FlyBaseID:FBgn0053505 Length:484 Species:Drosophila melanogaster


Alignment Length:180 Identity:37/180 - (20%)
Similarity:66/180 - (36%) Gaps:42/180 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 INWSSPSGKLLEEAIVLNEDEQIFGLSKAVLQMQTH--RVLLNSIF---------PSVSFLMVYT 193
            :.|.:.:||:||::.||:..|:    .:...:.::|  .:.|:|..         |.:......|
  Fly   185 LKWCTETGKVLEKSDVLSHREE----PETGKKRRSHVISICLSSDMKYLALAEGGPHIQIWCPQT 245

  Fly   194 MGHYLNLR------LDLFARHGSVRFVLYSILGLFGLGLWS----------FMKDYNQVSTDAEI 242
            |.|...|:      ..|..|.|:  ..|||......:.:||          |.......|.||..
  Fly   246 MKHIKTLKGHRDSVAGLVFRKGT--HDLYSAAKDRSVKIWSLDEMAYVESLFGHQTAVTSIDALS 308

  Fly   243 DQRLATMGP--------QLVAAGASFYDKHLKKNIALRELIGNDVYTALG 284
            .:|..|.|.        ::.......|:.| |.:|...:.|.::.:.:.|
  Fly   309 RERAITAGGSDCSLRIWKITEESQLIYNGH-KDSIECVKYINDEHFVSGG 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33506NP_001014528.1 None
U3-55KNP_001014529.1 Upf2 55..>125 CDD:281974
WD40 <150..484 CDD:225201 37/180 (21%)
WD40 156..416 CDD:295369 37/180 (21%)
WD40 repeat 163..203 CDD:293791 7/17 (41%)
WD40 repeat 218..254 CDD:293791 7/35 (20%)
WD40 repeat 259..295 CDD:293791 8/37 (22%)
WD40 repeat 302..336 CDD:293791 6/33 (18%)
WD40 repeat 342..379 CDD:293791 3/16 (19%)
WD40 repeat 391..431 CDD:293791
WD40 repeat 436..461 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0299
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.