DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33506 and Rrp9

DIOPT Version :9

Sequence 1:NP_001014528.1 Gene:CG33506 / 3346177 FlyBaseID:FBgn0053506 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_663595.1 Gene:Rrp9 / 27966 MGIID:2384313 Length:475 Species:Mus musculus


Alignment Length:172 Identity:35/172 - (20%)
Similarity:67/172 - (38%) Gaps:48/172 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 EEIKRADIR-FRDKQINWSSPSGKLLEEAIVLNEDEQIFGLSKAVL-QMQTHRVLLNSIFPSVSF 188
            :|.::|:.| |.:.|:     :|:|.|:.:     ||...|.|:|. ::|.         |:.:.
Mouse    93 QEEEKAEARAFEEDQV-----AGRLKEDVL-----EQRGRLQKSVAKEIQA---------PAPTD 138

  Fly   189 LMVYTMGHYLNLRLDLFARHGSVRFVLYSILGLFGLGLWSFMKDYNQVSTDAEIDQRL-----AT 248
            :.| ..||.|:              :...::....|.::|..||...:....|..::|     |.
Mouse   139 IRV-LRGHQLS--------------ITCLVITPDDLAIFSAAKDCTIIKWSVETGRKLHVIPRAK 188

  Fly   249 MGPQLVAAGASFYDKHLKKNIALRELIGNDVYTALGNENYMI 290
            .|.|...||.|       .::....:..:..|.|.|:.:.:|
Mouse   189 KGAQGQPAGHS-------SHVLCMAISSDGKYLASGDRSKLI 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33506NP_001014528.1 None
Rrp9NP_663595.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75
Nuclear localization signal. /evidence=ECO:0000255 8..40
WD40 <136..403 CDD:225201 20/110 (18%)
WD40 139..439 CDD:238121 20/107 (19%)
WD 1 144..183 9/52 (17%)
WD40 repeat 149..197 CDD:293791 9/47 (19%)
WD 2 197..236 6/34 (18%)
WD40 repeat 203..239 CDD:293791 4/21 (19%)
WD 3 239..278
WD40 repeat 244..280 CDD:293791
WD 4 281..320
WD40 repeat 287..320 CDD:293791
WD 5 322..360
WD40 repeat 327..363 CDD:293791
WD 6 374..413
WD40 repeat 379..421 CDD:293791
WD 7 419..460
WD40 repeat 424..449 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0299
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.