DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btsz and AT1G03370

DIOPT Version :9

Sequence 1:NP_001247109.1 Gene:btsz / 3346167 FlyBaseID:FBgn0266756 Length:3734 Species:Drosophila melanogaster
Sequence 2:NP_171836.3 Gene:AT1G03370 / 839519 AraportID:AT1G03370 Length:1020 Species:Arabidopsis thaliana


Alignment Length:274 Identity:65/274 - (23%)
Similarity:111/274 - (40%) Gaps:60/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  3413 LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHTPISSL 3477
            |:|.||..::|.|:|. ...|||||::.|...:|     :|||.|..|||.:.|...|  .:..|
plant     3 LQVRVVEARNLPAMDL-NGFSDPYVRLQLGKQRS-----RTKVVKKNLNPKWTEDFSF--GVDDL 59

  Fly  3478 ESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQ----WYLLQERSEPFDEVATYRGDIV 3538
            ... |.::|...|.:..:||:|:|.|:: ..:||.....    ||.|..:.:             
plant    60 NDE-LVVSVLDEDKYFNDDFVGQVRVSV-SLVFDAENQSLGTVWYPL
NPKKK------------- 109

  Fly  3539 VGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPI 3603
             |.|....|.:....||:.:|:.              .:.|..::||......:.::     |||
plant   110 -GSKKDCGEILLKICFSQKNSVL--------------DLTSSGDQTSASRSPDLRLE-----SPI 154

  Fly  3604 KANGTCDAFCKS---YLLPDRTRSSK-----QKTPVVKRTLHPSWNYTFVYEDVSLEELSERALE 3660
            ..: ||.:..:|   ..:|..|.:.:     ||..:   |..|:.:.:...:...|.|:|:....
plant   155 DPS-TCASPSRSDDASSIPQTTFAGRFTQIFQKNAI---TATPTQSSSRSIDASDLSEISKPVFS 215

  Fly  3661 LTVWDHDRLASNEF 3674
            |.: ..|..:|..|
plant   216 LEL-SEDESSSTSF 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btszNP_001247109.1 FYVE_Slp3_4_5 26..73 CDD:277286
SOBP <300..476 CDD:291927
C2A_SLP 3398..3520 CDD:176056 36/110 (33%)
C2B_SLP_1-2-3-4 3534..3723 CDD:175987 28/149 (19%)
AT1G03370NP_171836.3 C2 2..104 CDD:395116 36/110 (33%)
DUF4782 252..401 CDD:406424
C2 535..637 CDD:395116
PH-GRAM_C2-GRAM 699..812 CDD:270039
DUF4782 851..992 CDD:406424
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I3424
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1065
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.