DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btsz and Syt13

DIOPT Version :9

Sequence 1:NP_001247109.1 Gene:btsz / 3346167 FlyBaseID:FBgn0266756 Length:3734 Species:Drosophila melanogaster
Sequence 2:NP_110466.2 Gene:Syt13 / 80977 RGDID:621877 Length:426 Species:Rattus norvegicus


Alignment Length:322 Identity:68/322 - (21%)
Similarity:124/322 - (38%) Gaps:76/322 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  3399 QVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRS-DPYVKVYLLPDKSKAGKRKTKVKKHTLNP 3462
            ::.|.:.|:.|.:.|.|     ..|.||.:..... |.|::..:.. |:.:.:.:|.:||..|:.
  Rat   161 KLHFRLDYDQKKAELFV-----TSLEAVTSDHEGGCDCYIQGSVAV-KTGSVEAQTALKKRQLHT 219

  Fly  3463 IFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQWYLLQERSEPF 3527
            .::|.:........|.:.||.||:...|.|.|:..:||:.:.|.|.......:||..|:..::  
  Rat   220 TWEEGLTLPLGEEELPTATLTLTLRTCDRFSRHSVIGELRLGLNGASVPLGTAQWGELKTTAK-- 282

  Fly  3528 DEVATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLHV 3592
             |.:...|::::.:.|:|..|                                        :|.|
  Rat   283 -EPSAGTGEVLLSISYLPAAN----------------------------------------RLLV 306

  Fly  3593 LVKEAKHLSPIKANGTC--DAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFVYEDVSLEELS 3655
            ::.:||:|...::....  |...|..|.....:..|::|...|..::|.||...::| :..:.|.
  Rat   307 VLIKAKNLHSNQSKELLGKDVSVKVTLKHQAQKLKKKQTKRAKHKINPVWNEMIMFE-LPDDLLQ 370

  Fly  3656 ERALELTVWDHDRLASNEFVGGIRFSLGTGR-----SYGRQVEWMDATGKELSLWQNMLDRP 3712
            ..::||.|                  ||.|.     ..||....:.|:|.|.|.|:.||..|
  Rat   371 ASSVELEV------------------LGQGEEGPSCELGRCSLGLHASGSERSHWEEMLKNP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btszNP_001247109.1 FYVE_Slp3_4_5 26..73 CDD:277286
SOBP <300..476 CDD:291927
C2A_SLP 3398..3520 CDD:176056 30/121 (25%)
C2B_SLP_1-2-3-4 3534..3723 CDD:175987 36/186 (19%)
Syt13NP_110466.2 C2 160..277 CDD:301316 30/121 (25%)
C2B_Synaptotagmin-13 288..425 CDD:176052 36/186 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.