DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btsz and SYT13

DIOPT Version :9

Sequence 1:NP_001247109.1 Gene:btsz / 3346167 FlyBaseID:FBgn0266756 Length:3734 Species:Drosophila melanogaster
Sequence 2:NP_065877.1 Gene:SYT13 / 57586 HGNCID:14962 Length:426 Species:Homo sapiens


Alignment Length:309 Identity:66/309 - (21%)
Similarity:122/309 - (39%) Gaps:64/309 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  3407 NYKLSALEVHVVRCKDLAAVDAKRNRS-DPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRF 3470
            :|.....|:.|.|   |.||.:..:.. |.||: ..:.:::.:.:.:|.:||..|:..::|.:..
Human   167 DYDCQKAELFVTR---LEAVTSNHDGGCDCYVQ-GSVANRTGSVEAQTALKKRQLHTTWEEGLVL 227

  Fly  3471 HTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQWYLLQERSEPFDEVATYRG 3535
            ......|.:.||.||:...|.|.|:...||:.:.|.|.......:||..|:..::   |.:...|
Human   228 PLAEEELPTATLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGEL
KTSAK---EPSAGAG 289

  Fly  3536 DIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLHVLVKEAKHL 3600
            ::::.:.|:|..|                                        :|.|::.:||:|
Human   290 EVLLSISYLPAAN----------------------------------------RLLVVLIKAKNL 314

  Fly  3601 SPIKANGTC--DAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFVYEDVSLEELSERALELTV 3663
            ...::....  |...|..|.....:..|::|...|..::|.||...::| :..:.|...::||.|
Human   315 HSNQSKELLGKDVSVKVTLKHQARKLKKKQTKRAKHKINPVWNEMIMFE-LPDDLLQASSVELEV 378

  Fly  3664 WDHDRLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKELSLWQNMLDRP 3712
            ...|....:..:|  ..|||           :..:|.|.|.|:.||..|
Human   379 LGQDDSGQSCALG--HCSLG-----------LHTSGSERSHWEEMLKNP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btszNP_001247109.1 FYVE_Slp3_4_5 26..73 CDD:277286
SOBP <300..476 CDD:291927
C2A_SLP 3398..3520 CDD:176056 29/113 (26%)
C2B_SLP_1-2-3-4 3534..3723 CDD:175987 35/181 (19%)
SYT13NP_065877.1 C2A_Synaptotagmin-13 160..277 CDD:176059 29/113 (26%)
C2B_Synaptotagmin-13 288..425 CDD:176052 35/181 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.