DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btsz and Syt8

DIOPT Version :9

Sequence 1:NP_001247109.1 Gene:btsz / 3346167 FlyBaseID:FBgn0266756 Length:3734 Species:Drosophila melanogaster
Sequence 2:XP_006508695.1 Gene:Syt8 / 55925 MGIID:1859867 Length:402 Species:Mus musculus


Alignment Length:318 Identity:80/318 - (25%)
Similarity:132/318 - (41%) Gaps:79/318 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  3398 GQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKR-KTKVKKHTLN 3461
            |::..:::|::....:.|.:.:..:|.|    ...:|||..|.:   .:::|:| :|||.:.||:
Mouse   122 GRLLLSLEYDFGSQEIRVGLRQAGNLKA----EGTADPYAWVSV---STQSGRRHETKVHRGTLS 179

  Fly  3462 PIFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDFLGEV-----SVNLQGRLFDNPQSQWYLLQ 3521
            |:|:||..|..|.:.|...||.:.:|....|..::.|||:     :|:||..|     ..||.| 
Mouse   180 PMFEETCCFLVPPAELPKATLKVQLWDFKRFSEHEPLGELQLPLGTVDLQHVL-----ESWYQL- 238

  Fly  3522 ERSEPFDEVATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSK 3586
              ..|........|::...|:|:|                                        .
Mouse   239 --GPPGTTEPEQMGELCFSLRYVP----------------------------------------S 261

  Fly  3587 GGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFVYEDVSL 3651
            .|.|.|:|.||:.|:|    |..:|:.|..|:.::.:..|.||...|.|..|.:|..||:. |.:
Mouse   262 SGSLTVVVLEARGLNP----GLAEAYVKIQLMLNQRKWKKSKTSSKKGTTTPYFNEAFVFL-VPV 321

  Fly  3652 EELSERALELTVWDHDRLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKELSLWQNML 3709
            .:|....|.|.||........|.||  :..||:           .|:|:.|..|.:||
Mouse   322 SQLQSVDLVLAVWARGLQLRTEPVG--KVLLGS-----------RASGQPLQHWADML 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btszNP_001247109.1 FYVE_Slp3_4_5 26..73 CDD:277286
SOBP <300..476 CDD:291927
C2A_SLP 3398..3520 CDD:176056 36/127 (28%)
C2B_SLP_1-2-3-4 3534..3723 CDD:175987 42/176 (24%)
Syt8XP_006508695.1 C2 122..240 CDD:417471 37/132 (28%)
C2 249..379 CDD:417471 42/176 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.