DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btsz and SYT17

DIOPT Version :9

Sequence 1:NP_001247109.1 Gene:btsz / 3346167 FlyBaseID:FBgn0266756 Length:3734 Species:Drosophila melanogaster
Sequence 2:XP_011544168.1 Gene:SYT17 / 51760 HGNCID:24119 Length:481 Species:Homo sapiens


Alignment Length:431 Identity:111/431 - (25%)
Similarity:175/431 - (40%) Gaps:100/431 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  3315 KVAAEELSR--SPVIGQRQAD-----GSGSPIQSRASSETWPTQSDEDIDR-----LVAMHQNRS 3367
            ::::.|..|  ||:|..:..:     ....|||......|:   :.:|..|     |.::..|..
Human   115 RISSLESRRPSSPLIDIKPIEFGVLSAKKEPIQPSVLRRTY---NPDDYFRKFEPHLYSLDSNSD 176

  Fly  3368 SLSSLGVRSESMASVYSGAGEGRYGTVVVKGQVEFAMQYNYKLSALEVHVVRCKDL---AAVDAK 3429
            .:.||  ..|.:.|.|.            .|.:.|:.||:...:.|.|.|:..:||   .:.|..
Human   177 DVDSL--TDEEILSKYQ------------LGMLHFSTQYDLLHNHLTVRVIEARDLPPPISHDGS 227

  Fly  3430 RN---RSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHTPISSLESRTLWLTVWHSDM 3491
            |.   .|:||||:.||||:..:  ::|.||:.|..|:|:|...|..|....:.|||.|||...|.
Human   228 RQDMAHSNPYVKICLLPDQKNS--KQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDK 290

  Fly  3492 FGRNDFLGEVSVNLQGRLFDNPQSQWYLLQERSEPFDEVATYRGDIVVGLKYIPPENIKSSFFSR 3556
            |.|:..:|:|||.|...........|..|...|:  :||..  |::::.|.|:|           
Human   291 FSRHCVIGKVSVPLCEVDLVKGGHWWKALIPSSQ--NEVEL--GELLLSLNYLP----------- 340

  Fly  3557 GSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDR 3621
                                         ..|:|:|.|..||.|.....:...|.|.|..|:...
Human   341 -----------------------------SAGRLNVDVIRAKQLLQTDVSQGSDPFVKIQLVHGL 376

  Fly  3622 TRSSKQKTPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGI---RFSLG 3683
            .....:||..::.|:.|.:|.:|.:: |..|||...:|..||:.|:..:||:|:|.|   ::|.|
Human   377 KLVKTKKTSFLRGTIDPFYNESFSFK-VPQEELENASLVFTVFGHNMKSSNDFIGRIVIGQYSSG 440

  Fly  3684 TGRSYGRQVEWMDATGKELSLWQNMLDRPNFWVEGSLVLRS 3724
            .               .|.:.|:.||:.....||....|||
Human   441 P---------------SETNHWRRMLNTHRTAVEQWHSLRS 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btszNP_001247109.1 FYVE_Slp3_4_5 26..73 CDD:277286
SOBP <300..476 CDD:291927
C2A_SLP 3398..3520 CDD:176056 44/127 (35%)
C2B_SLP_1-2-3-4 3534..3723 CDD:175987 42/191 (22%)
SYT17XP_011544168.1 C2A_Synaptotagmin-15-17 193..321 CDD:176036 45/129 (35%)
C2B_Synaptotagmin-17 330..464 CDD:176055 42/189 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.