DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btsz and Syt2

DIOPT Version :9

Sequence 1:NP_001247109.1 Gene:btsz / 3346167 FlyBaseID:FBgn0266756 Length:3734 Species:Drosophila melanogaster
Sequence 2:XP_038946276.1 Gene:Syt2 / 24805 RGDID:3804 Length:499 Species:Rattus norvegicus


Alignment Length:331 Identity:104/331 - (31%)
Similarity:161/331 - (48%) Gaps:65/331 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  3385 GAGEGRYGTVVVK-GQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKA 3448
            |.|||........ |:::|::.|:::.:.|.|.|::..:|.|:| ....|||||||:|||||.| 
  Rat   207 GEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALD-MGGTSDPYVKVFLLPDKKK- 269

  Fly  3449 GKRKTKVKKHTLNPIFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNP 3513
             |.:|||.:.||||.|:||..|..|...|..:||.:.::..|.|.::|.:|||.|.:.......|
  Rat   270 -KYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQP 333

  Fly  3514 QSQWYLLQ--ERSEPFDEVATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKS 3576
            ..:|..||  |:.||     ...|||...|:|:|                               
  Rat   334 IEEWRDLQGGEKEEP-----EKLGDICTSLRYVP------------------------------- 362

  Fly  3577 VASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWN 3641
                     ..|:|.|.:.|||:|..:...|..|.:.|.:|:.:..|..|:||.|.|:||:|.:|
  Rat   363 ---------TAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFN 418

  Fly  3642 YTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKELSLWQ 3706
            .:|.:| :..|::.:..:.:||.|:|:|..||.:|  :..:|:           :|||.||..|.
  Rat   419 ESFSFE-IPFEQIQKVQVVVTVLDYDKLGKNEAIG--KIFVGS-----------NATGTELRHWS 469

  Fly  3707 NMLDRP 3712
            :||..|
  Rat   470 DMLANP 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btszNP_001247109.1 FYVE_Slp3_4_5 26..73 CDD:277286
SOBP <300..476 CDD:291927
C2A_SLP 3398..3520 CDD:176056 47/121 (39%)
C2B_SLP_1-2-3-4 3534..3723 CDD:175987 48/179 (27%)
Syt2XP_038946276.1 Syt2_N 81..193 CDD:409249
C2A_Synaptotagmin-1-5-6-9-10 219..341 CDD:176031 47/124 (38%)
C2B_Synaptotagmin-1 351..486 CDD:176047 48/179 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.