DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btsz and snt-3

DIOPT Version :9

Sequence 1:NP_001247109.1 Gene:btsz / 3346167 FlyBaseID:FBgn0266756 Length:3734 Species:Drosophila melanogaster
Sequence 2:NP_001379881.1 Gene:snt-3 / 190698 WormBaseID:WBGene00004923 Length:284 Species:Caenorhabditis elegans


Alignment Length:316 Identity:93/316 - (29%)
Similarity:161/316 - (50%) Gaps:65/316 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  3398 GQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNP 3462
            |::::.:.|::..::|.|.:::.::|.|:|. ...||||||::|||||.|  |.:|||::.:|||
 Worm    17 GRLQYKLDYDFDKNSLTVVIIQAEELPAMDL-GGTSDPYVKLFLLPDKKK--KLQTKVQRKSLNP 78

  Fly  3463 IFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQWYLLQERSEPF 3527
            :|:|:..|..|.:.:..:||.|.|:..|.||::|.:|::|:.| |::      ......||::..
 Worm    79 VFNESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQIGQISIPL-GKV------DLAATLERTDLI 136

  Fly  3528 DEVATYR-GDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLH 3591
            :.....| |::.:.|:|:|.:|                                        :|.
 Worm   137 ESPPENRLGEVCLALRYVPNKN----------------------------------------KLS 161

  Fly  3592 VLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFVYEDVSLEELSE 3656
            |:|.|.|:|..:...|..|.:.|.||:....|..|:||.:..:||:|.:|.:|.: ||:.|::..
 Worm   162 VVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSF-DVTSEKMQR 225

  Fly  3657 RALELTVWDHDRLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKELSLWQNMLDRP 3712
            ..|.:||.|:||:.|||.:|.:  .:||           .|||..|..|.:||..|
 Worm   226 VHLHVTVSDYDRVGSNERIGQV--IIGT-----------CATGVALKQWNDMLATP 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btszNP_001247109.1 FYVE_Slp3_4_5 26..73 CDD:277286
SOBP <300..476 CDD:291927
C2A_SLP 3398..3520 CDD:176056 42/121 (35%)
C2B_SLP_1-2-3-4 3534..3723 CDD:175987 49/180 (27%)
snt-3NP_001379881.1 C2 16..131 CDD:417471 42/123 (34%)
C2B_Synaptotagmin-1 144..278 CDD:176047 48/179 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.