DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btsz and snt-7

DIOPT Version :9

Sequence 1:NP_001247109.1 Gene:btsz / 3346167 FlyBaseID:FBgn0266756 Length:3734 Species:Drosophila melanogaster
Sequence 2:NP_510526.2 Gene:snt-7 / 181615 WormBaseID:WBGene00011682 Length:416 Species:Caenorhabditis elegans


Alignment Length:252 Identity:56/252 - (22%)
Similarity:93/252 - (36%) Gaps:60/252 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  3362 MHQNR--SSLSSLGVRSESMASVYSGAGEGRYGTVVVKGQVEFAMQYNYKLSALEVHVVRCKDLA 3424
            :|||:  ..|.......||..|..         |:...|.::.::.::..|:.|.|.:|:     
 Worm   116 LHQNQFDRGLYQFPTGDESACSSV---------TMSAVGSIQLSVSHDVNLNLLTVTIVK----- 166

  Fly  3425 AVDAKRNRSD----PYVKVYL-LPDKSKAG-KRKTKVKKHTLNPIFDETMRFHTPISSLESRTLW 3483
            |||....|.|    |::||.| :||..|.. ..:||....|.:|:.:|...|......:....|.
 Worm   167 AVDLPTKREDDLPNPFMKVSLEIPDSKKPNVDHQTKTYNGTASPLINEDFYFSVTSQQVSICRLE 231

  Fly  3484 LTVWHSDMFGRNDFLGEVSVNLQGRL-----FDNPQSQWYLLQERSEPFDEVATYR-------GD 3536
            :.|:..|.|..::.:|...:.| ||:     .|.|...|          .||..|.       |.
 Worm   232 VMVYDYDQFSVDECVGYCWLTL-GRINEHFEHDLPTLFW----------AEVLPYEDGENKGYGQ 285

  Fly  3537 IVVGLKYIPPE--------NIKSSFFSRGSSIT-------GSSSNLRKFGGSIKSVA 3578
            ::..|.|:...        .:::..|..|.::.       |....|:|...|:|..|
 Worm   286 VLFALSYLSHAQRLTMNIFKVRNVRFRNGGNVALRVTLLDGEEKPLKKKKTSLKKAA 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btszNP_001247109.1 FYVE_Slp3_4_5 26..73 CDD:277286
SOBP <300..476 CDD:291927
C2A_SLP 3398..3520 CDD:176056 34/132 (26%)
C2B_SLP_1-2-3-4 3534..3723 CDD:175987 11/67 (16%)
snt-7NP_510526.2 C2 145..257 CDD:387358 31/117 (26%)
C2 283..>374 CDD:387358 11/60 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.