DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btsz and LOC103909492

DIOPT Version :9

Sequence 1:NP_001247109.1 Gene:btsz / 3346167 FlyBaseID:FBgn0266756 Length:3734 Species:Drosophila melanogaster
Sequence 2:XP_009293982.1 Gene:LOC103909492 / 103909492 -ID:- Length:185 Species:Danio rerio


Alignment Length:130 Identity:53/130 - (40%)
Similarity:77/130 - (59%) Gaps:5/130 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly  3398 GQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNP 3462
            |::.:.:.||:..|.|.|.|:|.:.|||:|.. ..|||||||||||||.|  |.:|||.:.||.|
Zfish    58 GKLLYTLDYNFTDSTLIVGVIRAEGLAAMDMS-GTSDPYVKVYLLPDKKK--KFETKVHRKTLEP 119

  Fly  3463 IFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQWYLLQ--ERSE 3525
            .|:|...|..|.:.|..:||.:||:..|.|.::|.:|:|.:.:....|.:...:|..||  |:.|
Zfish   120 TFNEHFTFKVPYAELGGKTLVMTVYDFDRFSKHDAIGDVRLQMNKVDFSHLTEEWRDLQKAEKEE 184

  Fly  3526  3525
            Zfish   185  184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btszNP_001247109.1 FYVE_Slp3_4_5 26..73 CDD:277286
SOBP <300..476 CDD:291927
C2A_SLP 3398..3520 CDD:176056 49/121 (40%)
C2B_SLP_1-2-3-4 3534..3723 CDD:175987
LOC103909492XP_009293982.1 C2A_Synaptotagmin-1-5-6-9-10 56..179 CDD:176031 50/123 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.