DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btsz and syt1b

DIOPT Version :9

Sequence 1:NP_001247109.1 Gene:btsz / 3346167 FlyBaseID:FBgn0266756 Length:3734 Species:Drosophila melanogaster
Sequence 2:NP_001082930.1 Gene:syt1b / 100034471 ZFINID:ZDB-GENE-060503-166 Length:388 Species:Danio rerio


Alignment Length:274 Identity:87/274 - (31%)
Similarity:132/274 - (48%) Gaps:54/274 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  3398 GQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNP 3462
            |::.:.:.||:..|.|.|.|:|.:.|||:|.. ..|||||||||||||.|  |.:|||.:.||.|
Zfish   145 GKLLYTLDYNFTDSTLIVGVIRAEGLAAMDMS-GTSDPYVKVYLLPDKKK--KFETKVHRKTLEP 206

  Fly  3463 IFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQWYLLQERSEPF 3527
            .|:|...|..|.:.|..:||.:||:..|.|.::|.:|:|.:.:....|.:...:|..||:..:  
Zfish   207 TFNEHFTFKVPYAELGGKTLVMTVYDFDRFSKHDAIGDVRLQMNKVDFSHLTEEWRDLQKAEK-- 269

  Fly  3528 DEVATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLHV 3592
             |.....|||.:.|:|:|                                        ..|:|.|
Zfish   270 -EEQERLGDICLSLRYVP----------------------------------------TAGKLTV 293

  Fly  3593 LVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFVYEDVSLEELSER 3657
            :|.|||:|..:...|..|.:.|.:|:.:..|..|:||.:.|.||:|.:|.:|.:| |..|::...
Zfish   294 VVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFE-VPSEQIQRH 357

  Fly  3658 ALELTVWDHDRLAS 3671
                  |. |.||:
Zfish   358 ------WS-DMLAN 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btszNP_001247109.1 FYVE_Slp3_4_5 26..73 CDD:277286
SOBP <300..476 CDD:291927
C2A_SLP 3398..3520 CDD:176056 49/121 (40%)
C2B_SLP_1-2-3-4 3534..3723 CDD:175987 35/138 (25%)
syt1bNP_001082930.1 C2A_Synaptotagmin-1-5-6-9-10 143..266 CDD:176031 50/123 (41%)
C2 275..376 CDD:301316 35/138 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.