powered by:
Protein Alignment CG14300 and CG3348
DIOPT Version :9
Sequence 1: | NP_001014639.1 |
Gene: | CG14300 / 3346166 |
FlyBaseID: | FBgn0038643 |
Length: | 94 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001303428.1 |
Gene: | CG3348 / 50082 |
FlyBaseID: | FBgn0040609 |
Length: | 98 |
Species: | Drosophila melanogaster |
Alignment Length: | 66 |
Identity: | 18/66 - (27%) |
Similarity: | 32/66 - (48%) |
Gaps: | 0/66 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 GRSACKDESEIGQTYTHHFDAAKYWLCETLGVPATEVDCPAGLAYMHLLKECIPWASYIWKKPEM 89
|..:|:...|:.:.:.:::|...||:|:..|..|....||....|...|..|:.:|.:.|..|:.
Fly 20 GEPSCQGLDEVNRMFRNYWDPTAYWVCDKQGTRARLQRCPQSQLYSEELGRCVHYADWAWTDPKE 84
Fly 90 P 90
|
Fly 85 P 85
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14300 | NP_001014639.1 |
None |
CG3348 | NP_001303428.1 |
ChtBD2 |
24..73 |
CDD:214696 |
13/48 (27%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45449183 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20987 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.940 |
|
Return to query results.
Submit another query.