DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gfrl and gfra1b

DIOPT Version :9

Sequence 1:NP_001247206.1 Gene:Gfrl / 3346162 FlyBaseID:FBgn0262869 Length:1279 Species:Drosophila melanogaster
Sequence 2:NP_571806.1 Gene:gfra1b / 79377 ZFINID:ZDB-GENE-010226-3 Length:481 Species:Danio rerio


Alignment Length:329 Identity:75/329 - (22%)
Similarity:111/329 - (33%) Gaps:80/329 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PTDKSLSSATTALETDLAIGRSGSTIKGVVAIL---NCILARQLCFEDPSCSAILEIIPRVCGPI 121
            |.:..||.          |.|....|.|..|..   ||:.|.:.|..:.:|.....:....|   
Zfish   135 PVNSRLSD----------IFRLAPIISGEAAFTKDNNCLNAAKACNLNDTCKKYRSLYISPC--- 186

  Fly   122 PVSCSTVTVT------KCQAALRTLQAFQFFRPT----------CLCKEPGMDPDCNHFRDFLFD 170
               .|.|:.|      ||..|||     |||...          |.|.. |....|:..|.....
Zfish   187 ---TSRVSTTEVCNKRKCHKALR-----QFFDKVPPKHSYGMLFCSCPS-GDHSACSERRRQTIV 242

  Fly   171 HPCGFVLKKAEKDPYPIDALPTCNHALSVCQQERKCLKLFEDFKTHCKVRDNK---CKMENRDAC 232
            ..|.:  :..||        |.|....:.|:....|.....||.|:|:.....   |..||...|
Zfish   243 PACSY--EDKEK--------PNCLSLQASCKTNYICRSRLADFLTNCQPEARSISGCLKENYADC 297

  Fly   233 HDSWTNL---------------RLSPMFGCICPNN-HMKKRCDRIFNIVNHNPCVDRLI-FFPNG 280
            ..:::.|               .:||.  |.|.|: :.|..||:......:|.|:...| .|.||
Zfish   298 LLAYSGLIGTVMTPNYLRAPGISVSPW--CDCSNSGNGKAECDKFTEFFTNNRCLRNAIQAFGNG 360

  Fly   281 LP-KLKQPRPKAKPRPKPKPKSKPKPRQRHHGMNGTELMTNNIEYHDEP-----NGLSDPEDEAN 339
            .. .:.||:|.....| ..|.:.||.|.|.........:||:::.:.:.     ..|...:.::|
Zfish   361 TDVGVWQPQPPIMSTP-ADPYTPPKGRDRTSNALDDPTLTNDLDSNADHLYSFCGSLQAQKLKSN 424

  Fly   340 ETVD 343
            .|:|
Zfish   425 VTLD 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GfrlNP_001247206.1 GDNF 94..173 CDD:280506 21/94 (22%)
GDNF 193..270 CDD:197975 21/95 (22%)
GDNF 641..727 CDD:197975
GDNF 751..832 CDD:280506
gfra1bNP_571806.1 GDNF 41..123 CDD:197975
GDNF 162..245 CDD:280506 21/94 (22%)
GDNF 255..349 CDD:280506 21/95 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584248
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10269
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.